PDB entry 6gmi

View 6gmi on RCSB PDB site
Description: genetic engineering of an artificial metalloenzyme for transfer hydrogenation of a self-immolative substrate in e. coli's periplasm.
Deposited on 2018-05-26, released 2018-10-10
The last revision was dated 2018-10-31, with a file datestamp of 2018-10-26.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22629 (13-End)
      • expression tag (11-12)
      • engineered mutation (110)
      • engineered mutation (142)
  • Heterogens: 4IR, IR3, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6gmiA (A:)
asmtggqqmgrdqagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgryd
sapatdgsgtalgwtvawknnyrnahsattwsgqyvggaearintqwlltvgttsplsea
ltkanspaeaykasrgaganawastlvghdtftkvkpsaasidaakkagvnngnpldavq
q

    Sequence, based on observed residues (ATOM records):
    >6gmiA (A:)
dqagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
lgwtvawknnyrnahsattwsgqyvggaearintqwlltvgttnawastlvghdtftkvk