PDB entry 6gmf

View 6gmf on RCSB PDB site
Description: Structure of Cytochrome P450 CYP109Q5 from Chondromyces apiculatus
Class: oxidoreductase
Keywords: P450, terpene, oxidoreductase, biocatalysis
Deposited on 2018-05-25, released 2019-03-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-03-27, with a file datestamp of 2019-03-22.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative cytochrome P450 hydroxylase
    Species: Chondromyces apiculatus DSM 436 [TaxId:1192034]
    Gene: CAP_4855
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gmfa_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6gmfA (A:)
    miadiditapevlrnpyalfaelrrtsavgrlqpqgfmavgryqdvarvlhdakgfsnrg
    waaslprgvkwdtsmppsivqvdpprhgklrtlvtkaftprtvaqleprirdiahelvdg
    lrgkstfeatvevtvpmpmiviaemlgvaperradfkrwsddmvgslalvrvgnaaqler
    stqefyayfsevleerrrepredlisqllaaevdgekltagevlsfantlliagnettts
    lignalvaltdhpeqlaaaqadlslvpavveevlryespaqcifrqtmtdveigderipa
    rsvvlpllasanrdesrfpdpdrfdihrdtkghlafgldihfcigaplarleakvmlevl
    larlgdiqrvsqevswspsffirspstlplratvasa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gmfA (A:)
    miadiditapevlrnpyalfaelrrtsavgrlqpqgfmavgryqdvarvlhdakgfsnrg
    waaslprgvkwdtsmppsivqvdpprhgklrtlvtkaftprtvaqleprirdiahelvdg
    lrgkstfeatvevtvpmpmiviaemlgvaperradfkrwsddmvaqlerstqefyayfse
    vleerrrepredlisqllaaevdgekltagevlsfantlliagnetttslignalvaltd
    hpeqlaaaqadlslvpavveevlryespaqcifrqtmtdveigderiparsvvlpllasa
    nrdesrfpdpdrfdihrdtkghlafgldihfcigaplarleakvmlevllarlgdiqrvs
    qevswspsffirspstlplratvasa