PDB entry 6gmc

View 6gmc on RCSB PDB site
Description: 1.2 A resolution structure of human hydroxyacid oxidase 1 bound with FMN and 4-carboxy-5-[(4-chlorophenyl)sulfanyl]-1,2,3-thiadiazole
Class: oxidoreductase
Keywords: glycolate, glyoxylate, peroxisome, FMN, primary hyperoxaluria, OXIDOREDUCTASE
Deposited on 2018-05-24, released 2018-06-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-13, with a file datestamp of 2018-06-08.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: N/A
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hydroxyacid oxidase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: HAO1, GOX1, HAOX1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gmca_
  • Heterogens: EDO, FMN, C7C, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6gmcA (A:)
    mlprlicindyeqhaksvlpksiydyyrsgandeetladniaafsrwklyprmlrnvaet
    dlstsvlgqrvsmpicvgatamqrmahvdgelatvracqslgtgmmlsswatssieevae
    agpealrwlqlyiykdrevtkklvrqaekmgykaifvtvdtpylgnrlddvrnrfklppq
    lrmknfetstlsfspeenfgddsglaayvakaidpsiswedikwlrrltslpivakgilr
    gddareavkhglngilvsnhgarqldgvpatidvlpeiveavegkvevfldggvrkgtdv
    lkalalgakavfvgrpivwglafqgekgvqdvleilkeefrlamalsgcqnvkvidktlv
    rknplavs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gmcA (A:)
    mlprlicindyeqhaksvlpksiydyyrsgandeetladniaafsrwklyprmlrnvaet
    dlstsvlgqrvsmpicvgatamqrmahvdgelatvracqslgtgmmlsswatssieevae
    agpealrwlqlyiykdrevtkklvrqaekmgykaifvtvdtpylgnrlddvrnrfklppq
    lrmknfstlsfspeenfgddsglaayvakaidpsiswedikwlrrltslpivakgilrgd
    dareavkhglngilvsnhgarqldgvpatidvlpeiveavegkvevfldggvrkgtdvlk
    alalgakavfvgrpivwglafqgekgvqdvleilkeefrlamalsgcqnvkvidktlvrk