PDB entry 6gmb

View 6gmb on RCSB PDB site
Description: Structure of human hydroxyacid oxidase 1 bound with FMN and glycolate
Class: oxidoreductase
Keywords: glycolate, glyoxylate, peroxisome, FMN, primary hyperoxaluria, Structural Genomics, Structural Genomics Consortium, SGC, OXIDOREDUCTASE
Deposited on 2018-05-24, released 2018-06-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-13, with a file datestamp of 2018-06-08.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: N/A
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hydroxyacid oxidase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: HAO1, GOX1, HAOX1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gmba_
  • Heterogens: EDO, PG4, FMN, GOA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6gmbA (A:)
    mlprlicindyeqhaksvlpksiydyyrsgandeetladniaafsrwklyprmlrnvaet
    dlstsvlgqrvsmpicvgatamqrmahvdgelatvracqslgtgmmlsswatssieevae
    agpealrwlqlyiykdrevtkklvrqaekmgykaifvtvdtpylgnrlddvrnrfklppq
    lrmknfetstlsfspeenfgddsglaayvakaidpsiswedikwlrrltslpivakgilr
    gddareavkhglngilvsnhgarqldgvpatidvlpeiveavegkvevfldggvrkgtdv
    lkalalgakavfvgrpivwglafqgekgvqdvleilkeefrlamalsgcqnvkvidktlv
    rk