PDB entry 6glw

View 6glw on RCSB PDB site
Description: Structure of galectin-10 in complex with the Fab fragment of a Charcot-Leyden crystal solubilizing antibody, 1D11
Class: sugar binding protein
Keywords: Fab, galectin-10, autocrystallizing, crystal solubilisation, SUGAR BINDING PROTEIN
Deposited on 2018-05-23, released 2019-06-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-06-05, with a file datestamp of 2019-05-30.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Galectin-10
    Species: Homo sapiens [TaxId:9606]
    Gene: CLC, LGALS10, LGALS10A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6glwa_
  • Chain 'B':
    Compound: Galectin-10
    Species: Homo sapiens [TaxId:9606]
    Gene: CLC, LGALS10, LGALS10A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6glwb_
  • Chain 'C':
    Compound: Fab 1D11 - Heavy chain
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 6GLW (0-End)
  • Chain 'D':
    Compound: Fab 1D11 - Light chain
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 6GLW
    Domains in SCOPe 2.07: d6glwd1, d6glwd2
  • Chain 'H':
    Compound: Fab 1D11 - Heavy chain
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 6GLW (0-229)
  • Chain 'L':
    Compound: Fab 1D11 - Light chain
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 6GLW (0-215)
    Domains in SCOPe 2.07: d6glwl1, d6glwl2
  • Heterogens: PG4, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6glwA (A:)
    mastthhhhhhdtdipttgggsrpddddkenlyfqghmsllpvpyteaaslstgstvtik
    grplacflnepylqvdfhtemkeesdivfhfqvcfgrrvvmnsreygawkqqvesknmpf
    qdgqefelsisvlpdkyqvmvngqssytfdhrikpeavkmvqvwrdisltkfnvsylkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6glwA (A:)
    sllpvpyteaaslstgstvtikgrplacflnepylqvdfhtemkeesdivfhfqvcfgrr
    vvmnsreygawkqqvesknmpfqdgqefelsisvlpdkyqvmvngqssytfdhrikpeav
    kmvqvwrdisltkfnvsyl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6glwB (B:)
    mastthhhhhhdtdipttgggsrpddddkenlyfqghmsllpvpyteaaslstgstvtik
    grplacflnepylqvdfhtemkeesdivfhfqvcfgrrvvmnsreygawkqqvesknmpf
    qdgqefelsisvlpdkyqvmvngqssytfdhrikpeavkmvqvwrdisltkfnvsylkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6glwB (B:)
    msllpvpyteaaslstgstvtikgrplacflnepylqvdfhtemkeesdivfhfqvcfgr
    rvvmnsreygawkqqvesknmpfqdgqefelsisvlpdkyqvmvngqssytfdhrikpea
    vkmvqvwrdisltkfnvsy
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6glwD (D:)
    qsvltqppsvsgspgetvtiscagtssdvgygnyvswyqqlpgmaprlliyevnkrasgi
    tdrfsgsksgntasltisglqsedegdyycasyrssnnavfgggthltvlgqpkaapsvt
    lfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaass
    ylsltpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6glwD (D:)
    svltqppsvsgspgetvtiscagtssdvgygnyvswyqqlpgmaprlliyevnkrasgit
    drfsgsksgntasltisglqsedegdyycasyrssnnavfgggthltvlgqpkaapsvtl
    fppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassy
    lsltpeqwkshrsyscqvthegstvektvapte
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6glwL (L:)
    qsvltqppsvsgspgetvtiscagtssdvgygnyvswyqqlpgmaprlliyevnkrasgi
    tdrfsgsksgntasltisglqsedegdyycasyrssnnavfgggthltvlgqpkaapsvt
    lfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaass
    ylsltpeqwkshrsyscqvthegstvektvaptecs