PDB entry 6glr

View 6glr on RCSB PDB site
Description: Crystal structure of hMTH1 N33G in complex with TH scaffold 1 in the presence of acetate
Class: hydrolase
Keywords: Inhibitor, Complex, Hydrolase, DNA repair, Fragment
Deposited on 2018-05-23, released 2019-02-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-20, with a file datestamp of 2019-02-15.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 7,8-dihydro-8-oxoguanine triphosphatase
    Species: Homo sapiens [TaxId:9606]
    Gene: NUDT1, MTH1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P36639 (26-181)
      • expression tag (24-25)
      • engineered mutation (58)
    Domains in SCOPe 2.07: d6glra1, d6glra2
  • Chain 'B':
    Compound: 7,8-dihydro-8-oxoguanine triphosphatase
    Species: Homo sapiens [TaxId:9606]
    Gene: NUDT1, MTH1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P36639 (26-181)
      • expression tag (24-25)
      • engineered mutation (58)
    Domains in SCOPe 2.07: d6glrb1, d6glrb2
  • Heterogens: F3E, ACT, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6glrA (A:)
    mkhhhhhhpmsdydipttenlyfqgamgasrlytlvlvlqpqrvllgmkkrgfgagrwgg
    fggkvqegetiedgarrelqeesgltvdalhkvgqivfefvgepelmdvhvfctdsiqgt
    pvesdemrpcwfqldqipfkdmwpddsywfplllqkkkfhgyfkfqgqdtildytlrevd
    tv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6glrA (A:)
    gamgasrlytlvlvlqpqrvllgmkkrgfgagrwggfggkvqegetiedgarrelqeesg
    ltvdalhkvgqivfefvgepelmdvhvfctdsiqgtpvesdemrpcwfqldqipfkdmwp
    ddsywfplllqkkkfhgyfkfqgqdtildytlrevdtv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6glrB (B:)
    mkhhhhhhpmsdydipttenlyfqgamgasrlytlvlvlqpqrvllgmkkrgfgagrwgg
    fggkvqegetiedgarrelqeesgltvdalhkvgqivfefvgepelmdvhvfctdsiqgt
    pvesdemrpcwfqldqipfkdmwpddsywfplllqkkkfhgyfkfqgqdtildytlrevd
    tv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6glrB (B:)
    gamgasrlytlvlvlqpqrvllgmkkrgfgagrwggfggkvqegetiedgarrelqeesg
    ltvdalhkvgqivfefvgepelmdvhvfctdsiqgtpvesdemrpcwfqldqipfkdmwp
    ddsywfplllqkkkfhgyfkfqgqdtildytlrevdtv