PDB entry 6glb

View 6glb on RCSB PDB site
Description: Crystal structure of JAK3 in complex with Compound 20 (FM484)
Class: transferase
Keywords: kinase, jak3, covalent inhibitor, reversible covalent inhibitor, induced pocket, arginine pocket, structural genomics consortium, sgc, transferase
Deposited on 2018-05-23, released 2018-06-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-27, with a file datestamp of 2018-06-22.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase JAK3
    Species: Homo sapiens [TaxId:9606]
    Gene: JAK3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P52333 (Start-293)
      • conflict (139)
      • conflict (230)
      • conflict (238)
    Domains in SCOPe 2.07: d6glba_
  • Chain 'B':
    Compound: Tyrosine-protein kinase JAK3
    Species: Homo sapiens [TaxId:9606]
    Gene: JAK3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P52333 (Start-293)
      • conflict (139)
      • conflict (230)
      • conflict (238)
    Domains in SCOPe 2.07: d6glbb_
  • Heterogens: F48, PHU, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6glbA (A:)
    smqdptifeerhlkyisqlgkgnfgsvelcrydplgdntgalvavkqlqhsgpdqqrdfq
    reiqilkalhsdfivkyrgvsygpgrqslrlvmeylpsgclrdflqrhrarldasrllly
    ssqickgmeylgsrrcvhralaarnilveseahvkiadfglakllpldkdyyvvrepgqs
    pifwyapeslsdnifsrqsdvwsfgvvlyelftycdkscspsaeflrmmgserdvpalsr
    llelleegqrlpappacpaevhelmklcwapspqdrpsfsalgpqldmlwsgsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6glbA (A:)
    dptifeerhlkyisqlgkgnfgsvelcrydplgdntgalvavkqlqhsgpdqqrdfqrei
    qilkalhsdfivkyrgvsygpgrqslrlvmeylpsgclrdflqrhrarldasrlllyssq
    ickgmeylgsrrcvhralaarnilveseahvkiadfglakllpldkdyyvvrqspifwya
    peslsdnifsrqsdvwsfgvvlyelftycdkscspsaeflrmmgserdvpalsrllelle
    egqrlpappacpaevhelmklcwapspqdrpsfsalgpqldmlwsgsr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6glbB (B:)
    smqdptifeerhlkyisqlgkgnfgsvelcrydplgdntgalvavkqlqhsgpdqqrdfq
    reiqilkalhsdfivkyrgvsygpgrqslrlvmeylpsgclrdflqrhrarldasrllly
    ssqickgmeylgsrrcvhralaarnilveseahvkiadfglakllpldkdyyvvrepgqs
    pifwyapeslsdnifsrqsdvwsfgvvlyelftycdkscspsaeflrmmgserdvpalsr
    llelleegqrlpappacpaevhelmklcwapspqdrpsfsalgpqldmlwsgsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6glbB (B:)
    dptifeerhlkyisqlgkgnfgsvelcrydplgdntgalvavkqlqhsgpdqqrdfqrei
    qilkalhsdfivkyrgvsygpgrqslrlvmeylpsgclrdflqrhrarldasrlllyssq
    ickgmeylgsrrcvhralaarnilveseahvkiadfglakllpldkdyyvvrqspifwya
    peslsdnifsrqsdvwsfgvvlyelftycdkscspsaeflrmmgserdvpalsrllelle
    egqrlpappacpaevhelmklcwapspqdrpsfsalgpqldmlwsgsr