PDB entry 6gl8

View 6gl8 on RCSB PDB site
Description: Crystal structure of Bcl-2 in complex with the novel orally active inhibitor S55746
Class: apoptosis
Keywords: APOPTOSIS-INHIBITOR COMPLEX, BCL-2, BH3-mimetics, APOPTOSIS
Deposited on 2018-05-23, released 2018-11-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-07, with a file datestamp of 2018-11-02.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Apoptosis regulator Bcl-2,Apoptosis regulator Bcl-2,Apoptosis regulator Bcl-2,Bcl-2-like protein 1,Apoptosis regulator Bcl-2,Apoptosis regulator Bcl-2,Apoptosis regulator Bcl-2
    Species: Homo sapiens [TaxId:9606]
    Gene: BCL2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10415 (15-39)
      • expression tag (13-14)
    • PDB 6GL8 (40-56)
    • Uniprot P10415 (57-End)
      • engineered mutation (60)
      • engineered mutation (64)
    Domains in SCOPe 2.07: d6gl8a1, d6gl8a2
  • Heterogens: F3Q, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6gl8A (A:)
    mhhhhhhhhlvprgsydnreivmkyihyklsqrgyewdagadveenrteapegtesevvh
    ktlreagddfsrryrrdfaemssqlhltpftargrfatvveelfrdgvnwgrivaffefg
    gvmcvesvnremsplvdnialwmteylnrhlhtwiqdnggwdafvelygpsm
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gl8A (A:)
    gsydnreivmkyihyklsqrgyewdagadesevvhktlreagddfsrryrrdfaemssql
    hltpftargrfatvveelfrdgvnwgrivaffefggvmcvesvnremsplvdnialwmte
    ylnrhlhtwiqdnggwdafvelyg