PDB entry 6gkx

View 6gkx on RCSB PDB site
Description: Crystal structure of the R-type bacteriocin tube protein CD1364 from Clostridium difficile in the pre-assembled state
Class: structural protein
Keywords: Diffocin Tube, Structural protein
Deposited on 2018-05-22, released 2018-08-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-22, with a file datestamp of 2018-08-17.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative phage XkdM-like protein
    Species: Peptoclostridium difficile (strain 630) [TaxId:272563]
    Gene: CD630_13640
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gkxa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6gkxA (A:)
    mgpmanmearnvmsgtwgelwldgnkvaevkkfqakmeftkediiiagqmgtdtkymgyk
    gkgsitlyhvssrmhkligekikrgseprfvaisklndpdsygaeriavkniafddltla
    dwevgvkgeieapftfteydfldii
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gkxA (A:)
    rnvmsgtwgelwldgnkvaevkkfqakmeftkediiiagqmgtkymgykgkgsitlyhvs
    srmhkligekikrgseprfvaisklndpdsygaeriavkniafddltladwevgvkgeie
    apftfteydfldii