PDB entry 6gkw

View 6gkw on RCSB PDB site
Description: crystal structure of the r-type bacteriocin sheath protein cd1363 from clostridium difficile in the pre-assembled state
Deposited on 2018-05-22, released 2018-08-22
The last revision was dated 2018-08-29, with a file datestamp of 2018-08-24.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative phage XkdK-like protein
    Species: Peptoclostridium difficile (strain 630) [TaxId:272563]
    Gene: CD630_13630
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6gkwA (A:)
    gpmaiglpsinisfkelattvkersargiiamvlkdakalglneihekedipvdlsaenk
    eyinlalmgnvntpnkllvyviegeadiqtaldfletkefnylcmpkaveadktaiknwi
    iklrdidkvkvkavlgkvvgnhegiinfttedvlvgekkysvdeftsrvagliagtplsq
    svtytklsdvvdipkmtkvdaeskvnkgelilikeagairiargvnslteltaekgemfq
    kikivdtldiihsdirkviiddyigkvtnsydnkcllivaiksyleeleksaliesdstv
    eidfeaqksylkskgvdlsymtlqeikeantgskvflkakikvldamedidlsiei
    

    Sequence, based on observed residues (ATOM records):
    >6gkwA (A:)
    glpsinisfkelattvkersargiiamvlkdakalglneihekedipvdlsaenkeyinl
    almgnvntpnkllvyviegeadiqtaldfletkefnylcmpkaveadktaiknwiiklrd
    idkvkvkavlgkvvgnhegiinfttedvlvgekkysvdeftsrvagliagtplsqsvtyt
    klsdvvdipkmtkvdaeskvnkgelilikeagairiargvnslteltaekgemfqkikiv
    dtldiihsdirkviiddyigkvtnsydnkcllivaiksyleeleksaliesdstveidfe
    aqksylkskgvdlsymtlqeikeantgskvflkakikvldamedidlsiei