PDB entry 6gku

View 6gku on RCSB PDB site
Description: Structure of galectin-10 in complex with the Fab fragment of a Charcot-Leyden crystal solubilizing antibody, 6F5
Class: sugar binding protein
Keywords: Non-autocrystallizing, mutant, galectin-10, SUGAR BINDING PROTEIN
Deposited on 2018-05-21, released 2019-06-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-06-05, with a file datestamp of 2019-05-30.
Experiment type: XRAY
Resolution: 1.91 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Galectin-10
    Species: Homo sapiens [TaxId:9606]
    Gene: CLC, LGALS10, LGALS10A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gkua_
  • Chain 'H':
    Compound: Fab 6F5 - Heavy Chain
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 6GKU (0-End)
  • Chain 'L':
    Compound: Fab 6F5 - Light chain
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 6GKU (0-End)
    Domains in SCOPe 2.07: d6gkul1, d6gkul2
  • Heterogens: CA, PGE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6gkuA (A:)
    mastthhhhhhdtdipttgggsrpddddkenlyfqgghmsllpvpyteaaslstgstvti
    kgrplacflnepylqvdfhtemkeesdivfhfqvcfgrrvvmnsreygawkqqvesknmp
    fqdgqefelsisvlpdkyqvmvngqssytfdhrikpeavkmvqvwrdisltkfnvsylkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gkuA (A:)
    sllpvpyteaaslstgstvtikgrplacflnepylqvdfhtemkeesdivfhfqvcfgrr
    vvmnsreygawkqqvesknmpfqdgqefelsisvlpdkyqvmvngqssytfdhrikpeav
    kmvqvwrdisltkfnvsylk
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >6gkuL (L:)
    qagltqppsvsgtlgkavtiscagtssdigygnyvswyqqlpgtapklliykvsrrasgv
    pdrfsgsksgntaslsisglqsedeadyycasyryrnnvvfgggthltvlgqpkaapsvt
    lfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaass
    ylsltpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gkuL (L:)
    qagltqppsvsgtlgkavtiscagtssdigygnyvswyqqlpgtapklliykvsrrasgv
    pdrfsgsksgntaslsisglqsedeadyycasyryrnnvvfgggthltvlgqpkaapsvt
    lfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaass
    ylsltpeqwkshrsyscqvthegstvektvapte