PDB entry 6gkt

View 6gkt on RCSB PDB site
Description: X-ray structure of a non-autocrystallizing galectin-10 variant, Gal10-Tyr69Glu
Class: sugar binding protein
Keywords: Non-autocrystallizing, mutant, galectin-10, SUGAR BINDING PROTEIN
Deposited on 2018-05-21, released 2019-06-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-06-05, with a file datestamp of 2019-05-30.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Galectin-10
    Species: Homo sapiens [TaxId:9606]
    Gene: CLC, LGALS10, LGALS10A
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q05315
      • conflict (70)
    Domains in SCOPe 2.07: d6gkta_
  • Chain 'B':
    Compound: Galectin-10
    Species: Homo sapiens [TaxId:9606]
    Gene: CLC, LGALS10, LGALS10A
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q05315 (2-End)
      • conflict (70)
    Domains in SCOPe 2.07: d6gktb_
  • Chain 'C':
    Compound: Galectin-10
    Species: Homo sapiens [TaxId:9606]
    Gene: CLC, LGALS10, LGALS10A
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q05315
      • conflict (70)
    Domains in SCOPe 2.07: d6gktc_
  • Chain 'D':
    Compound: Galectin-10
    Species: Homo sapiens [TaxId:9606]
    Gene: CLC, LGALS10, LGALS10A
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q05315
      • conflict (70)
    Domains in SCOPe 2.07: d6gktd_
  • Chain 'E':
    Compound: Galectin-10
    Species: Homo sapiens [TaxId:9606]
    Gene: CLC, LGALS10, LGALS10A
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q05315
      • conflict (70)
    Domains in SCOPe 2.07: d6gkte_
  • Chain 'F':
    Compound: Galectin-10
    Species: Homo sapiens [TaxId:9606]
    Gene: CLC, LGALS10, LGALS10A
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q05315
      • conflict (70)
    Domains in SCOPe 2.07: d6gktf_
  • Heterogens: PGE, PG4, P6G, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6gktA (A:)
    ghmsllpvpyteaaslstgstvtikgrplacflnepylqvdfhtemkeesdivfhfqvcf
    grrvvmnsreegawkqqvesknmpfqdgqefelsisvlpdkyqvmvngqssytfdhrikp
    eavkmvqvwrdisltkfnvsylkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gktA (A:)
    sllpvpyteaaslstgstvtikgrplacflnepylqvdfhtemkeesdivfhfqvcfgrr
    vvmnsreegawkqqvesknmpfqdgqefelsisvlpdkyqvmvngqssytfdhrikpeav
    kmvqvwrdisltkfnvsylk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6gktB (B:)
    ghmsllpvpyteaaslstgstvtikgrplacflnepylqvdfhtemkeesdivfhfqvcf
    grrvvmnsreegawkqqvesknmpfqdgqefelsisvlpdkyqvmvngqssytfdhrikp
    eavkmvqvwrdisltkfnvsylkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gktB (B:)
    msllpvpyteaaslstgstvtikgrplacflnepylqvdfhtemkeesdivfhfqvcfgr
    rvvmnsreegawkqqvesknmpfqdgqefelsisvlpdkyqvmvngqssytfdhrikpea
    vkmvqvwrdisltkfnvsylk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6gktC (C:)
    ghmsllpvpyteaaslstgstvtikgrplacflnepylqvdfhtemkeesdivfhfqvcf
    grrvvmnsreegawkqqvesknmpfqdgqefelsisvlpdkyqvmvngqssytfdhrikp
    eavkmvqvwrdisltkfnvsylkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gktC (C:)
    sllpvpyteaaslstgstvtikgrplacflnepylqvdfhtemkeesdivfhfqvcfgrr
    vvmnsreegawkqqvesknmpfqdgqefelsisvlpdkyqvmvngqssytfdhrikpeav
    kmvqvwrdisltkfnvsy
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6gktD (D:)
    ghmsllpvpyteaaslstgstvtikgrplacflnepylqvdfhtemkeesdivfhfqvcf
    grrvvmnsreegawkqqvesknmpfqdgqefelsisvlpdkyqvmvngqssytfdhrikp
    eavkmvqvwrdisltkfnvsylkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gktD (D:)
    sllpvpyteaaslstgstvtikgrplacflnepylqvdfhtemkeesdivfhfqvcfgrr
    vvmnsreegawkqqvesknmpfqdgqefelsisvlpdkyqvmvngqssytfdhrikpeav
    kmvqvwrdisltkfnvsylk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6gktE (E:)
    ghmsllpvpyteaaslstgstvtikgrplacflnepylqvdfhtemkeesdivfhfqvcf
    grrvvmnsreegawkqqvesknmpfqdgqefelsisvlpdkyqvmvngqssytfdhrikp
    eavkmvqvwrdisltkfnvsylkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gktE (E:)
    sllpvpyteaaslstgstvtikgrplacflnepylqvdfhtemkeesdivfhfqvcfgrr
    vvmnsreegawkqqvesknmpfqdgqefelsisvlpdkyqvmvngqssytfdhrikpeav
    kmvqvwrdisltkfnvsylk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6gktF (F:)
    ghmsllpvpyteaaslstgstvtikgrplacflnepylqvdfhtemkeesdivfhfqvcf
    grrvvmnsreegawkqqvesknmpfqdgqefelsisvlpdkyqvmvngqssytfdhrikp
    eavkmvqvwrdisltkfnvsylkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gktF (F:)
    sllpvpyteaaslstgstvtikgrplacflnepylqvdfhtemkeesdivfhfqvcfgrr
    vvmnsreegawkqqvesknmpfqdgqefelsisvlpdkyqvmvngqssytfdhrikpeav
    kmvqvwrdisltkfnvs