PDB entry 6gks

View 6gks on RCSB PDB site
Description: X-ray structure determined from recombinant Charcot-Leyden crystal
Class: sugar binding protein
Keywords: recombinant, human, galectin-10, SUGAR BINDING PROTEIN
Deposited on 2018-05-21, released 2019-06-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-06-05, with a file datestamp of 2019-05-30.
Experiment type: XRAY
Resolution: 1.38 Å
R-factor: N/A
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Galectin-10
    Species: Homo sapiens [TaxId:9606]
    Gene: CLC, LGALS10, LGALS10A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gksa_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6gksA (A:)
    ghmsllpvpyteaaslstgstvtikgrplacflnepylqvdfhtemkeesdivfhfqvcf
    grrvvmnsreygawkqqvesknmpfqdgqefelsisvlpdkyqvmvngqssytfdhrikp
    eavkmvqvwrdisltkfnvsylkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gksA (A:)
    sllpvpyteaaslstgstvtikgrplacflnepylqvdfhtemkeesdivfhfqvcfgrr
    vvmnsreygawkqqvesknmpfqdgqefelsisvlpdkyqvmvngqssytfdhrikpeav
    kmvqvwrdisltkfnvsylk