PDB entry 6gkj

View 6gkj on RCSB PDB site
Description: Translation initiation factor 4E in complex with trinucleotide mRNA 5' cap (m7GpppApG)
Class: translation
Keywords: Protein-ligand complex, translation initiation factor, eIF4E, mRNA 5' cap, m7GpppApG, translation
Deposited on 2018-05-21, released 2019-06-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-06-19, with a file datestamp of 2019-06-14.
Experiment type: XRAY
Resolution: 2.07 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: eukaryotic translation initiation factor 4e
    Species: Mus musculus [TaxId:10090]
    Gene: eif4e
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gkja_
  • Chain 'B':
    Compound: eukaryotic translation initiation factor 4e
    Species: Mus musculus [TaxId:10090]
    Gene: eif4e
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gkjb_
  • Chain 'C':
    Compound: eukaryotic translation initiation factor 4e
    Species: Mus musculus [TaxId:10090]
    Gene: eif4e
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gkjc_
  • Chain 'D':
    Compound: eukaryotic translation initiation factor 4e
    Species: Mus musculus [TaxId:10090]
    Gene: eif4e
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gkjd_
  • Heterogens: MGP, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6gkjA (A:)
    vanpehyikhplqnrwalwffkndksktwqanlrliskfdtvedfwalynhiqlssnlmp
    gcdyslfkdgiepmwedeknkrggrwlitlnkqqrrsdldrfwletllcligesfddysd
    dvcgavvnvrakgdkiaiwttecenrdavthigrvykerlglppkivigyqshadtatks
    gsttknrfvv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gkjA (A:)
    vanpehyikhplqnrwalwffkndksktwqanlrliskfdtvedfwalynhiqlssnlmp
    gcdyslfkdgiepmwedeknkrggrwlitlnkqqrrsdldrfwletllcligesfddysd
    dvcgavvnvrakgdkiaiwttecenrdavthigrvykerlglppkivigyqshadtatkn
    rfvv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6gkjB (B:)
    vanpehyikhplqnrwalwffkndksktwqanlrliskfdtvedfwalynhiqlssnlmp
    gcdyslfkdgiepmwedeknkrggrwlitlnkqqrrsdldrfwletllcligesfddysd
    dvcgavvnvrakgdkiaiwttecenrdavthigrvykerlglppkivigyqshadtatks
    gsttknrfvv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gkjB (B:)
    npehyikhplqnrwalwffkndksktwqanlrliskfdtvedfwalynhiqlssnlmpgc
    dyslfkdgiepmwedeknkrggrwlitlnkqqrrsdldrfwletllcligesfddysddv
    cgavvnvrakgdkiaiwttecenrdavthigrvykerlglppkivigyqshadtatknrf
    vv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6gkjC (C:)
    vanpehyikhplqnrwalwffkndksktwqanlrliskfdtvedfwalynhiqlssnlmp
    gcdyslfkdgiepmwedeknkrggrwlitlnkqqrrsdldrfwletllcligesfddysd
    dvcgavvnvrakgdkiaiwttecenrdavthigrvykerlglppkivigyqshadtatks
    gsttknrfvv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gkjC (C:)
    pehyikhplqnrwalwffkndksktwqanlrliskfdtvedfwalynhiqlssnlmpgcd
    yslfkdgiepmwedeknkrrwlitlnkqqrrsdldrfwletllcligesfddysddvcga
    vvnvrakgdkiaiwttecenrdavthigrvykerlglppkivigyqshknrfvv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6gkjD (D:)
    vanpehyikhplqnrwalwffkndksktwqanlrliskfdtvedfwalynhiqlssnlmp
    gcdyslfkdgiepmwedeknkrggrwlitlnkqqrrsdldrfwletllcligesfddysd
    dvcgavvnvrakgdkiaiwttecenrdavthigrvykerlglppkivigyqshadtatks
    gsttknrfvv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gkjD (D:)
    pehyikhplqnrwalwffkndksktwqanlrliskfdtvedfwalynhiqlssnlmpgcd
    yslfkdgiepmwedeknkrggrwlitlnkqqrrsdldrfwletllcligesfddysddvc
    gavvnvrakgdkiaiwttecenrdavthigrvykerlglppkivigyqshadtatknrfv
    v