PDB entry 6gke

View 6gke on RCSB PDB site
Description: Aleuria aurantia lectin AAL N224Q mutant in complex with Fucalpha1-6GlcNAc
Class: sugar binding protein
Keywords: lectin, propeller, fucose, SUGAR BINDING PROTEIN
Deposited on 2018-05-19, released 2019-06-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-06-19, with a file datestamp of 2019-06-14.
Experiment type: XRAY
Resolution: 1.08 Å
R-factor: N/A
AEROSPACI score: 0.74 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fucose-specific lectin
    Species: Aleuria aurantia [TaxId:5188]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18891 (0-311)
      • engineered mutation (223)
    Domains in SCOPe 2.07: d6gkea_
  • Heterogens: NDG, FUC, GOL, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6gkeA (A:)
    pteflytskiaaiswaatggrqqrvyfqdlngkireaqrggdnpwtggssqnvigeaklf
    splaavtwksaqgiqirvycvnkdnilsefvydgskwitgqlgsvgvkvgsnsklaalqw
    ggsesappnirvyyqksngsgssiheyvwsgkwtagasfgstvpgtgigataigpgrlri
    yyqatdnkirehcwdsnswyvggfsasasagvsiaaiswgstpqirvywqkgreelyeaa
    yggswntpgqikdasrptpslpdtfiaanssgnidisvffqasgvslqqwqwisgkgwsi
    gavvptgtpagwlehhhhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gkeA (A:)
    pteflytskiaaiswaarqqrvyfqdlngkireaqrggdnpwtggssqnvigeaklfspl
    aavtwksaqgiqirvycvnkdnilsefvydgskwitgqlgsvgvkvgsnsklaalqwggs
    esappnirvyyqksngsgssiheyvwsgkwtagasfgstvpgtgigataigpgrlriyyq
    atdnkirehcwdsnswyvggfsasasagvsiaaiswgstpqirvywqkgreelyeaaygg
    swntpgqikdasrptpslpdtfiaanssgnidisvffqasgvslqqwqwisgkgwsigav
    vptgtpagw