PDB entry 6gk7

View 6gk7 on RCSB PDB site
Description: crystal structure of anti-tau antibody dmcbtau-27.1, double mutant (s31y, t100i) of cbtau-27.1, in complex with tau peptide a8119b (residues 299-318)
Deposited on 2018-05-18, released 2018-06-13
The last revision was dated 2018-06-13, with a file datestamp of 2018-06-08.
Experiment type: XRAY
Resolution: 2.95 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: human tau peptide a8119 residues 299-318
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6GK7 (0-10)
  • Chain 'H':
    Compound: human fab antibody fragment of cbtau-27.1(s31y,t100i)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6GK7 (0-222)
  • Chain 'L':
    Compound: human fab antibody fragment of cbtau-27.1(s31y,t100i)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6GK7 (0-215)
  • Heterogens: CL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6gk7A (A:)
    ivykpvdlskv
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records:
    >6gk7H (H:)
    qvqlvesgpemrkpgeslkiscktsgyifsdywtawvrqlpgkglqwmgiiysgdsdtry
    hpsvqghvtmstdsslttaylqwsslkasdtgiyycarldarvdagwqldswgqgtlvtv
    ssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlq
    ssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkrvepk
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records:
    >6gk7L (L:)
    iqltqspdslavslgeratinckssqsvfyrdnnknylawyqhksgqppkllffwassre
    sgvsdrfsgsgsgtdftltidnlqaedvalyycqhyfniphnfgqgtkleikrtvaapsv
    fifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysl
    sstltlskadyekhkvyacevthqglsspvtksfnr