PDB entry 6gk6

View 6gk6 on RCSB PDB site
Description: Crystal structure of myxobacterial cytochrome P450 CYP267B1 in complex with myristic acid
Class: oxidoreductase
Keywords: Bacterial Proteins, Sorangium cellulosum, Cytochrome P-450 Enzyme System, Cytochrome P450, Hydroxylation, Heme, Oxidation-Reduction, Flavanone, Myristic acid, Tetradecanoic acid, Biocatalysis, OXIDOREDUCTASE
Deposited on 2018-05-18, released 2018-08-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-08, with a file datestamp of 2018-08-03.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome P450 CYP267B1 protein
    Species: Sorangium cellulosum [TaxId:448385]
    Gene: cypA6, sce7167
    Database cross-references and differences (RAF-indexed):
    • Uniprot A9ERX9 (Start-404)
      • expression tag (405-407)
    Domains in SCOPe 2.07: d6gk6a1, d6gk6a2
  • Heterogens: MYR, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6gk6A (A:)
    mvdqdafpelfhpssraephaiyarmraagrlhrlvhprldvpiwvavryddcvellkdp
    rlirdfrklpdevrrryfplsdrttfmdqhmldadppdhtrlraivqrafsprmmeglrp
    riqeiadglidavidrrrmeliadfafplptaviaellglpvedrgrfrrwtkillapak
    drefveraqpvveefaayfraladarrkaprddlisglllaeeqehklspaelssmvfll
    lvaghettvhliasgmllllshpaerrrldedpglvgsaveealrcegpaelstirwsle
    dielfgarvpagegvaagllaanrdpqhfpdpdrfdigrspnrhigfgggihfclgamla
    rieaaiafstllrrlprielatstrdivwsewptirgpaavpvvfhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gk6A (A:)
    afpelfhpssraephaiyarmraagrlhrlvhprldvpiwvavryddcvellkdprlird
    frklpdevrrryfplsdrttfmdqhmldadppdhtrlraivqrafsprmmeglrpriqei
    adglidavidrrrmeliadfafplptaviaellglpvedrgrfrrwtkillapakdrefv
    eraqpvveefaayfraladarrkaprddlisglllaeeqehklspaelssmvflllvagh
    ettvhliasgmllllshpaerrrldedpglvgsaveealrcegpaelstirwsledielf
    garvpagegvaagllaanrdpqhfpdpdrfdigrspnrhigfgggihfclgamlarieaa
    iafstllrrlprielatstrdivwsewptirgpaavpvvfhhh