PDB entry 6gk2

View 6gk2 on RCSB PDB site
Description: helical reconstruction of bcl10 card and malt1 death domain complex
Deposited on 2018-05-18, released 2018-10-31
The last revision was dated 2018-10-31, with a file datestamp of 2018-10-26.
Experiment type: EM
Resolution: 4.9 Å
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'F':
    Compound: Mucosa-associated lymphoid tissue lymphoma translocation protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: MALT1, MLT
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: B-cell lymphoma/leukemia 10
    Species: Homo sapiens [TaxId:9606]
    Gene: BCL10, CIPER, CLAP
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'F':
    Sequence, based on SEQRES records:
    >6gk2F (F:)
lnrlrepllrrlselldqapegrgwrrlaelagsrgrlrlscldleqcslkvlepegsps
lcllklmgekgctvtelsdflqamehtevlql

    Sequence, based on observed residues (ATOM records):
    >6gk2F (F:)
lnrlrepllrrlselldqapegrgwrrlaelagsscldleqcslkvlepegspslcllkl
mgekgctvtelsdflqamehtevlq

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records:
    >6gk2H (H:)
eedltevkkdalenlrvylcekiiaerhfdhlrakkilsredteeiscrtssrkragkll
dylqenpkgldtlvesirrektqnfliqkitdevlklrniklehlk