PDB entry 6gju

View 6gju on RCSB PDB site
Description: human NBD1 of CFTR in complex with nanobodies T2a and T4
Class: hydrolase
Keywords: Cystic Fibrosis, CFTR, nanobodies, thermal stabilization, conformational dynamics, hydrolase
Deposited on 2018-05-17, released 2019-06-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-06-26, with a file datestamp of 2019-06-21.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cystic fibrosis transmembrane conductance regulator
    Species: Homo sapiens [TaxId:9606]
    Gene: CFTR
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q20BJ8
      • engineered mutation (106)
      • engineered mutation (148)
      • engineered mutation (153)
  • Chain 'B':
    Compound: Nanobody T4
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 6GJU (0-End)
    Domains in SCOPe 2.07: d6gjub1, d6gjub2
  • Chain 'C':
    Compound: Nanobody T2a
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 6GJU (0-End)
    Domains in SCOPe 2.07: d6gjuc1, d6gjuc2
  • Heterogens: GOL, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6gjuB (B:)
    qvqlqesggglvqaggslrlscaasgstfaiiamgwyrqapgkqrelvavistgdtryad
    svkgrftisrdnakntvylqmdslrpedtavyycnaavqvrdyrnywgqgtqvtvssaaa
    hhhhhhgaaeqkliseedlngaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gjuB (B:)
    qvqlqesggglvqaggslrlscaasgstfaiiamgwyrqapgkqrelvavistgdtryad
    svkgrftisrdnakntvylqmdslrpedtavyycnaavqvrdyrnywgqgtqvtvssa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6gjuC (C:)
    qvqlqesggglvqaggslrlscaasgsifridamgwyrqapgkqrelvahstsggstdya
    dsvkgrftisrdnakntvylqmnslkpedtavyycnadvrtrwyasnnywgqgtqvtvss
    aaahhhhhhgaaeqkliseedlngaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gjuC (C:)
    qvqlqesggglvqaggslrlscaasgsifridamgwyrqapgkqrelvahstsggstdya
    dsvkgrftisrdnakntvylqmnslkpedtavyycnadvrtrwyasnnywgqgtqvtvss