PDB entry 6gjq

View 6gjq on RCSB PDB site
Description: human NBD1 of CFTR in complex with nanobody T27
Class: hydrolase
Keywords: Cystic Fibrosis, CFTR, nanobodies, thermal stabilization, conformational dynamics, hydrolase
Deposited on 2018-05-16, released 2019-06-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-06-26, with a file datestamp of 2019-06-21.
Experiment type: XRAY
Resolution: 2.49 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cystic fibrosis transmembrane conductance regulator
    Species: Homo sapiens [TaxId:9606]
    Gene: CFTR
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q20BJ8
      • engineered mutation (106)
      • engineered mutation (148)
      • engineered mutation (153)
    Domains in SCOPe 2.07: d6gjqa_
  • Chain 'B':
    Compound: Nanobody T27
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 6GJQ (0-End)
    Domains in SCOPe 2.07: d6gjqb1, d6gjqb2
  • Chain 'C':
    Compound: Cystic fibrosis transmembrane conductance regulator
    Species: Homo sapiens [TaxId:9606]
    Gene: CFTR
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q20BJ8
      • engineered mutation (106)
      • engineered mutation (148)
      • engineered mutation (153)
  • Chain 'D':
    Compound: Nanobody T27
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 6GJQ (0-End)
    Domains in SCOPe 2.07: d6gjqd1, d6gjqd2
  • Chain 'E':
    Compound: Cystic fibrosis transmembrane conductance regulator
    Species: Homo sapiens [TaxId:9606]
    Gene: CFTR
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q20BJ8
      • engineered mutation (106)
      • engineered mutation (148)
      • engineered mutation (153)
    Domains in SCOPe 2.07: d6gjqe_
  • Chain 'F':
    Compound: Nanobody T27
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 6GJQ (0-End)
    Domains in SCOPe 2.07: d6gjqf1, d6gjqf2
  • Chain 'G':
    Compound: Cystic fibrosis transmembrane conductance regulator
    Species: Homo sapiens [TaxId:9606]
    Gene: CFTR
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q20BJ8
      • engineered mutation (106)
      • engineered mutation (148)
      • engineered mutation (153)
    Domains in SCOPe 2.07: d6gjqg_
  • Chain 'H':
    Compound: Nanobody T27
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 6GJQ (0-End)
    Domains in SCOPe 2.07: d6gjqh1, d6gjqh2
  • Heterogens: ATP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6gjqA (A:)
    sltttevvmenvtafweegfgelfekakqnnnnrktsngddslffsnfsllgtpvlkdin
    fkiergqllavagstgagktsllmmimgelepsegkikhsgrisfcpqfswimpgtiken
    iifgvsydeyryrsvikacqleediskfpekdntvlgeggitlsggqrarislaravykd
    adlylldspfgyldvltekeifescvcklmanktrilvtskmehlkkadkililhegssy
    fygtfselqnlqpdfssklmg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gjqA (A:)
    dinfkiergqllavagstgagktsllmmimgelepsrisfcpqfswimpgtikeniifgv
    sydeyryrsvikacqleediskfpekdntvlgeggitlsggqrarislaravykdadlyl
    ldspfgyldvltekeifescvcklmanktrilvtskmehlkkadkililhegssyfygtf
    selqnlq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6gjqB (B:)
    qvqlqesgggleqpggslrlscatsgvifginamgwyrqapgkqrelvatftsggstnya
    dfvegrftisrdnakntvylqmnglrpedtavyychatvvvsrygltydywgqgtqvtvs
    saaahhhhhhgaaeqkliseedlngaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gjqB (B:)
    qvqlqesgggleqpggslrlscatsgvifginamgwyrqapgkqrelvatftsggstnya
    dfvegrftisrdnakntvylqmnglrpedtavyychatvvvsrygltydywgqgtqvtvs
    s
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6gjqD (D:)
    qvqlqesgggleqpggslrlscatsgvifginamgwyrqapgkqrelvatftsggstnya
    dfvegrftisrdnakntvylqmnglrpedtavyychatvvvsrygltydywgqgtqvtvs
    saaahhhhhhgaaeqkliseedlngaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gjqD (D:)
    qvqlqesgggleqpggslrlscatsgvifginamgwyrqapgkqrelvatftsggstnya
    dfvegrftisrdnakntvylqmnglrpedtavyychatvvvsrygltydywgqgtqvtvs
    s
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6gjqE (E:)
    sltttevvmenvtafweegfgelfekakqnnnnrktsngddslffsnfsllgtpvlkdin
    fkiergqllavagstgagktsllmmimgelepsegkikhsgrisfcpqfswimpgtiken
    iifgvsydeyryrsvikacqleediskfpekdntvlgeggitlsggqrarislaravykd
    adlylldspfgyldvltekeifescvcklmanktrilvtskmehlkkadkililhegssy
    fygtfselqnlqpdfssklmg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gjqE (E:)
    dinfkiergqllavagstgagktsllmmimgelepsrisfcpqfswimpgtikeniifgv
    sydeyryrsvikacqleediskfpekdntvlgeggitlsggqrarislaravykdadlyl
    ldspfgyldvltekeifescvcklmanktrilvtskmehlkkadkililhegssyfygtf
    selqnlq
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6gjqF (F:)
    qvqlqesgggleqpggslrlscatsgvifginamgwyrqapgkqrelvatftsggstnya
    dfvegrftisrdnakntvylqmnglrpedtavyychatvvvsrygltydywgqgtqvtvs
    saaahhhhhhgaaeqkliseedlngaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gjqF (F:)
    qvqlqesgggleqpggslrlscatsgvifginamgwyrqapgkqrelvatftsggstnya
    dfvegrftisrdnakntvylqmnglrpedtavyychatvvvsrygltydywgqgtqvtvs
    s
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >6gjqG (G:)
    sltttevvmenvtafweegfgelfekakqnnnnrktsngddslffsnfsllgtpvlkdin
    fkiergqllavagstgagktsllmmimgelepsegkikhsgrisfcpqfswimpgtiken
    iifgvsydeyryrsvikacqleediskfpekdntvlgeggitlsggqrarislaravykd
    adlylldspfgyldvltekeifescvcklmanktrilvtskmehlkkadkililhegssy
    fygtfselqnlqpdfssklmg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gjqG (G:)
    dinfkiergqllavagstgagktsllmmimgelepsrisfcpqfswimpgtikeniifgv
    sydeyryrsvikacqleediskfpekdntvlgeggitlsggqrarislaravykdadlyl
    ldspfgyldvltekeifescvcklmanktrilvtskmehlkkadkililhegssyfygtf
    selqnlq
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6gjqH (H:)
    qvqlqesgggleqpggslrlscatsgvifginamgwyrqapgkqrelvatftsggstnya
    dfvegrftisrdnakntvylqmnglrpedtavyychatvvvsrygltydywgqgtqvtvs
    saaahhhhhhgaaeqkliseedlngaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gjqH (H:)
    qvqlqesgggleqpggslrlscatsgvifginamgwyrqapgkqrelvatftsggstnya
    dfvegrftisrdnakntvylqmnglrpedtavyychatvvvsrygltydywgqgtqvtvs
    s