PDB entry 6gje

View 6gje on RCSB PDB site
Description: structure of the amnionless(20-357)-cubilin(36-135) complex
Deposited on 2018-05-16, released 2018-12-19
The last revision was dated 2019-06-12, with a file datestamp of 2019-06-07.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein amnionless
    Species: Homo sapiens [TaxId:9606]
    Gene: AMN, UNQ513/PRO1028
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Cubilin
    Species: Homo sapiens [TaxId:9606]
    Gene: CUBN, IFCR
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Cubilin
    Species: Homo sapiens [TaxId:9606]
    Gene: CUBN, IFCR
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Cubilin
    Species: Homo sapiens [TaxId:9606]
    Gene: CUBN, IFCR
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6gjeA (A:)
    vsklwvpntdfdvaanwsqnrtpcaggavefpadkmvsvlvqeghavsdmllpldgelvl
    asgagfgvsdvgshldcgagepavfrdsdrfswhdphlwrsgdeapglffvdaervpcrh
    ddvffppsasfrvglgpgaspvrvrsisalgrtftrdedlavflasragrlrfhgpgals
    vgpedcadpsgcvcgnaeaqpwicaallqplggrcpqaachsalrpqgqccdlcgavvll
    thgpafdleryrarildtflglpqyhglqvavskvprssrlreadteiqvvlvengpetg
    gagrlaralladvaengealgvleatmresgahvwgss
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6gjeB (B:)
    gelelqrqkrsinlqqprmatergnlvfltgsaqniefrtgslgkiklndedlseclhqi
    qknkediielkgsaiglpqnissqiyqlnsklvdlerkfqglqqtvdkkv
    

    Sequence, based on observed residues (ATOM records):
    >6gjeB (B:)
    qqprmatergnlvfltgsaqniefrtgslgkiklndedlseclhqiqknkediielkgsa
    iglpqnissqiyqlnsklvdle
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >6gjeC (C:)
    gelelqrqkrsinlqqprmatergnlvfltgsaqniefrtgslgkiklndedlseclhqi
    qknkediielkgsaiglpqnissqiyqlnsklvdlerkfqglqqtvdkkv
    

    Sequence, based on observed residues (ATOM records):
    >6gjeC (C:)
    nlqqprmatergnlvfltgsaqniefrtgslgkiklndedlseclhqiqknkediielkg
    saiglpqnissqiyqlnsklvdl
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >6gjeD (D:)
    gelelqrqkrsinlqqprmatergnlvfltgsaqniefrtgslgkiklndedlseclhqi
    qknkediielkgsaiglpqnissqiyqlnsklvdlerkfqglqqtvdkkv
    

    Sequence, based on observed residues (ATOM records):
    >6gjeD (D:)
    nlqqprmatergnlvfltgsaqniefrtgslgkiklndedlseclhqiqknkediielkg
    saiglpqnissqiyqlnsklvd