PDB entry 6gjb

View 6gjb on RCSB PDB site
Description: Erk2 signalling protein
Class: signaling protein
Keywords: Erk2, inhibitor, reversible probe, SIGNALING PROTEIN
Deposited on 2018-05-16, released 2019-01-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-02, with a file datestamp of 2018-12-28.
Experiment type: XRAY
Resolution: 1.82 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPK1, ERK2, PRKM1, PRKM2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gjba_
  • Heterogens: SO4, F0H, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6gjbA (A:)
    mahhhhhhmaaaaaagagpemvrgqvfdvgprytnlsyigegaygmvcsaydnvnkvrva
    ikkispfehqtycqrtlreikillrfrheniigindiiraptieqmkdvyivqdlmetdl
    ykllktqhlsndhicyflyqilrglkyihsanvlhrdlkpsnlllnttcdlkicdfglar
    vadpdhdhtgflteyvatrwyrapeimlnskgytksidiwsvgcilaemlsnrpifpgkh
    yldqlnhilgilgspsqedlnciinlkarnyllslphknkvpwnrlfpnadskaldlldk
    mltfnphkrieveqalahpyleqyydpsdepiaeapfkfdmelddlpkeklkelifeeta
    rfqpgyrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gjbA (A:)
    gagpemvrgqvfdvgprytnlsyigegaygmvcsaydnvnkvrvaikkispfehqtycqr
    tlreikillrfrheniigindiiraptieqmkdvyivqdlmetdlykllktqhlsndhic
    yflyqilrglkyihsanvlhrdlkpsnlllnttcdlkicdfglarvadpdhdhtgfltey
    vatrwyrapeimlnskgytksidiwsvgcilaemlsnrpifpgkhyldqlnhilgilgsp
    sqedlnciinlkarnyllslphknkvpwnrlfpnadskaldlldkmltfnphkrieveqa
    lahpyleqyydpsdepiaeapfkfelddlpkeklkelifeetarfqpg