PDB entry 6gj8

View 6gj8 on RCSB PDB site
Description: crystal structure of kras g12d (gppcp) in complex with bi 2852
Class: signaling protein
Keywords: kras 4b, k-ras 2, ki-ras, c-k-ras, c-ki-ras, gtpase kras, signaling protein
Deposited on 2018-05-16, released 2019-07-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-08-14, with a file datestamp of 2019-08-09.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GTPase KRas
    Species: Homo sapiens [TaxId:9606]
    Gene: KRAS, KRAS2, RASK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01116 (1-168)
      • expression tag (0)
      • engineered mutation (12)
    Domains in SCOPe 2.08: d6gj8a1, d6gj8a2
  • Heterogens: F0K, MG, GCP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6gj8A (A:)
    gmteyklvvvgadgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildta
    gqeeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcd
    lpsrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhke