PDB entry 6gj5

View 6gj5 on RCSB PDB site
Description: crystal structure of kras g12d (gppcp) in complex with 15
Class: signaling protein
Keywords: kras 4b, k-ras 2, ki-ras, c-k-ras, c-ki-ras, gtpase kras, signaling protein
Deposited on 2018-05-16, released 2019-07-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-07-31, with a file datestamp of 2019-07-26.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GTPase KRas
    Species: Homo sapiens [TaxId:9606]
    Gene: KRAS, KRAS2, RASK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01116 (1-End)
      • engineered mutation (12)
      • engineered mutation (118)
    Domains in SCOPe 2.07: d6gj5a_
  • Chain 'B':
    Compound: GTPase KRas
    Species: Homo sapiens [TaxId:9606]
    Gene: KRAS, KRAS2, RASK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01116 (1-169)
      • expression tag (0)
      • engineered mutation (12)
      • engineered mutation (118)
    Domains in SCOPe 2.07: d6gj5b1, d6gj5b2
  • Heterogens: GCP, MG, F0N, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6gj5A (A:)
    gmteyklvvvgadgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildta
    gqeeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnksd
    lpsrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhkek
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gj5A (A:)
    mteyklvvvgadgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
    qamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnksdlpsrt
    vdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6gj5B (B:)
    gmteyklvvvgadgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildta
    gqeeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnksd
    lpsrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhkek
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gj5B (B:)
    gmteyklvvvgadgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildta
    gdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnksdlpsrtvdt
    kqaqdlarsygipfietsaktrqgvddafytlvreirkhkek