PDB entry 6gj0

View 6gj0 on RCSB PDB site
Description: Human IMPase with Mn
Class: hydrolase
Keywords: IMPase, Complex, Lithium, HYDROLASE
Deposited on 2018-05-15, released 2018-10-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-17, with a file datestamp of 2018-10-12.
Experiment type: XRAY
Resolution: 1.73 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: inositol monophosphatase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: IMPA1, IMPA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gj0a_
  • Chain 'B':
    Compound: inositol monophosphatase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: IMPA1, IMPA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gj0b_
  • Heterogens: MN, GOL, MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6gj0A (A:)
    madpwqecmdyavtlarqagevvceaiknemnvmlksspvdlvtatdqkvekmlissike
    kypshsfigeesvaageksiltdnptwiidpidgttnfvhrfpfvavsigfavnkkiefg
    vvyscvegkmytarkgkgafcngqklqvsqqeditksllvtelgssrtpetvrmvlsnme
    klfcipvhgirsvgtaavnmclvatggadayyemgihcwdvagagiivteaggvlmdvtg
    gpfdlmsrrviaannrilaeriakeiqviplqrdded
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gj0A (A:)
    pwqecmdyavtlarqagevvceaiknemnvmlksspvdlvtatdqkvekmlissikekyp
    shsfigeesvaageksiltdnptwiidpidgttnfvhrfpfvavsigfavnkkiefgvvy
    scvegkmytarkgkgafcngqklqvsqqeditksllvtelgssrtpetvrmvlsnmeklf
    cipvhgirsvgtaavnmclvatggadayyemgihcwdvagagiivteaggvlmdvtggpf
    dlmsrrviaannrilaeriakeiqviplqrdded
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6gj0B (B:)
    madpwqecmdyavtlarqagevvceaiknemnvmlksspvdlvtatdqkvekmlissike
    kypshsfigeesvaageksiltdnptwiidpidgttnfvhrfpfvavsigfavnkkiefg
    vvyscvegkmytarkgkgafcngqklqvsqqeditksllvtelgssrtpetvrmvlsnme
    klfcipvhgirsvgtaavnmclvatggadayyemgihcwdvagagiivteaggvlmdvtg
    gpfdlmsrrviaannrilaeriakeiqviplqrdded
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gj0B (B:)
    dpwqecmdyavtlarqagevvceaiknemnvmlksspvdlvtatdqkvekmlissikeky
    pshsfigeesvaageksiltdnptwiidpidgttnfvhrfpfvavsigfavnkkiefgvv
    yscvegkmytarkgkgafcngqklqvsqqeditksllvtelgssrtpetvrmvlsnmekl
    fcipvhgirsvgtaavnmclvatggadayyemgihcwdvagagiivteaggvlmdvtggp
    fdlmsrrviaannrilaeriakeiqviplqrdded