PDB entry 6giv

View 6giv on RCSB PDB site
Description: Structure of GluA2-N775S ligand-binding domain (S1S2J) in complex with glutamate and Rubidium Bromide at 1.75 A resolution
Class: membrane protein
Keywords: Ionotropic glutamate receptor, GluA2-N775S ligand-binding domain, agonist, MEMBRANE PROTEIN, bromide ions
Deposited on 2018-05-15, released 2019-05-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-05-15, with a file datestamp of 2019-05-10.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutamate receptor 2
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Gria2, Glur2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19491 (2-116)
      • expression tag (0-1)
      • linker (117-118)
    • Uniprot P19491 (119-End)
      • engineered mutation (241)
    Domains in SCOPe 2.07: d6giva1, d6giva2
  • Heterogens: GLU, SO4, GOL, BR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6givA (A:)
    ganktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgk
    ygardadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtp
    iesaedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvar
    vrkskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlk
    lseqglldklknkwwydkgecgsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6givA (A:)
    ganktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgk
    ygardadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtp
    iesaedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvar
    vrkskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlk
    lseqglldklknkwwydkgecg