PDB entry 6gio

View 6gio on RCSB PDB site
Description: Structure of Amino Acid Amide Racemase from Ochrobactrum anthropi
Class: isomerase
Keywords: PLP, isomerase, amino acid, amino acid amide, amino acid ester, racemase
Deposited on 2018-05-14, released 2019-03-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-03-27, with a file datestamp of 2019-03-22.
Experiment type: XRAY
Resolution: 1.87 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Amino acid amide racemase
    Species: Ochrobactrum anthropi [TaxId:529]
    Gene: aaarA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gioa_
  • Chain 'B':
    Compound: Amino acid amide racemase
    Species: Ochrobactrum anthropi [TaxId:529]
    Gene: aaarA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6giob_
  • Chain 'C':
    Compound: Amino acid amide racemase
    Species: Ochrobactrum anthropi [TaxId:529]
    Gene: aaarA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gioc_
  • Chain 'D':
    Compound: Amino acid amide racemase
    Species: Ochrobactrum anthropi [TaxId:529]
    Gene: aaarA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6giod_
  • Heterogens: PLP, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6gioA (A:)
    mqtplslrerdarviaeigrlrfsplsliggkgnrlieeggrsildlsgsagpaalgygh
    paiveaveksvrdmagaslllypneaavslaedllritpgngerrvwfghsgsdandcav
    rvltaatkrsriisfigsyhgnltgsmgisghtamthtlprpgvlllpypdpfrprfsae
    avlelldyhfatscppeqvaavfiepilsdgglvvpppaflealqdrcrkhgilvvvdev
    kvglgrtglmhcfqheglepdmvvfgkglggglplsavvgpqwvmdhapafvlqttagnp
    vataagravlntierqglaqrservggifadrlrrlsdkhsiigdvrgrglaigvdlvsd
    rgsrepapvtttakiiyrgyqlgaaftyvglnanvlefmppltltepeideaadivdqai
    gdvldgkvadsdvahfmmw
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gioA (A:)
    lslrerdarviaeigrlrfsplsliggkgnrlieeggrsildlsgsagpaalgyghpaiv
    eaveksvrdmagaslllypneaavslaedllritpgngerrvwfghsgsdandcavrvlt
    aatkrsriisfigsyhgnltgsmgisghtamthtlprpgvlllpypdpfrprfsaeavle
    lldyhfatscppeqvaavfiepilsdgglvvpppaflealqdrcrkhgilvvvdevkvgl
    grtglmhcfqheglepdmvvfgkglggglplsavvgpqwvmdhapafvlqttagnpvata
    agravlntierqglaqrservggifadrlrrlsdkhsiigdvrgrglaigvdlvsdrgsr
    epapvtttakiiyrgyqlgaaftyvglnanvlefmppltltepeideaadivdqaigdvl
    dgkvadsdvahfm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6gioB (B:)
    mqtplslrerdarviaeigrlrfsplsliggkgnrlieeggrsildlsgsagpaalgygh
    paiveaveksvrdmagaslllypneaavslaedllritpgngerrvwfghsgsdandcav
    rvltaatkrsriisfigsyhgnltgsmgisghtamthtlprpgvlllpypdpfrprfsae
    avlelldyhfatscppeqvaavfiepilsdgglvvpppaflealqdrcrkhgilvvvdev
    kvglgrtglmhcfqheglepdmvvfgkglggglplsavvgpqwvmdhapafvlqttagnp
    vataagravlntierqglaqrservggifadrlrrlsdkhsiigdvrgrglaigvdlvsd
    rgsrepapvtttakiiyrgyqlgaaftyvglnanvlefmppltltepeideaadivdqai
    gdvldgkvadsdvahfmmw
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gioB (B:)
    tplslrerdarviaeigrlrfsplsliggkgnrlieeggrsildlsgsagpaalgyghpa
    iveaveksvrdmagaslllypneaavslaedllritpgngerrvwfghsgsdandcavrv
    ltaatkrsriisfigsyhgnltgsmgisghtamthtlprpgvlllpypdpfrprfsaeav
    lelldyhfatscppeqvaavfiepilsdgglvvpppaflealqdrcrkhgilvvvdevkv
    glgrtglmhcfqheglepdmvvfgkglggglplsavvgpqwvmdhapafvlqttagnpva
    taagravlntierqglaqrservggifadrlrrlsdkhsiigdvrgrglaigvdlvsdrg
    srepapvtttakiiyrgyqlgaaftyvglnanvlefmppltltepeideaadivdqaigd
    vldgkvadsdvahfm
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6gioC (C:)
    mqtplslrerdarviaeigrlrfsplsliggkgnrlieeggrsildlsgsagpaalgygh
    paiveaveksvrdmagaslllypneaavslaedllritpgngerrvwfghsgsdandcav
    rvltaatkrsriisfigsyhgnltgsmgisghtamthtlprpgvlllpypdpfrprfsae
    avlelldyhfatscppeqvaavfiepilsdgglvvpppaflealqdrcrkhgilvvvdev
    kvglgrtglmhcfqheglepdmvvfgkglggglplsavvgpqwvmdhapafvlqttagnp
    vataagravlntierqglaqrservggifadrlrrlsdkhsiigdvrgrglaigvdlvsd
    rgsrepapvtttakiiyrgyqlgaaftyvglnanvlefmppltltepeideaadivdqai
    gdvldgkvadsdvahfmmw
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gioC (C:)
    qtplslrerdarviaeigrlrfsplsliggkgnrlieeggrsildlsgsagpaalgyghp
    aiveaveksvrdmagaslllypneaavslaedllritpgngerrvwfghsgsdandcavr
    vltaatkrsriisfigsyhgnltgsmgisghtamthtlprpgvlllpypdpfrprfsaea
    vlelldyhfatscppeqvaavfiepilsdgglvvpppaflealqdrcrkhgilvvvdevk
    vglgrtglmhcfqheglepdmvvfgkglggglplsavvgpqwvmdhapafvlqttagnpv
    ataagravlntierqglaqrservggifadrlrrlsdkhsiigdvrgrglaigvdlvsdr
    gsrepapvtttakiiyrgyqlgaaftyvglnanvlefmppltltepeideaadivdqaig
    dvldgkvadsdvahfm
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6gioD (D:)
    mqtplslrerdarviaeigrlrfsplsliggkgnrlieeggrsildlsgsagpaalgygh
    paiveaveksvrdmagaslllypneaavslaedllritpgngerrvwfghsgsdandcav
    rvltaatkrsriisfigsyhgnltgsmgisghtamthtlprpgvlllpypdpfrprfsae
    avlelldyhfatscppeqvaavfiepilsdgglvvpppaflealqdrcrkhgilvvvdev
    kvglgrtglmhcfqheglepdmvvfgkglggglplsavvgpqwvmdhapafvlqttagnp
    vataagravlntierqglaqrservggifadrlrrlsdkhsiigdvrgrglaigvdlvsd
    rgsrepapvtttakiiyrgyqlgaaftyvglnanvlefmppltltepeideaadivdqai
    gdvldgkvadsdvahfmmw
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gioD (D:)
    lslrerdarviaeigrlrfsplsliggkgnrlieeggrsildlsgsagpaalgyghpaiv
    eaveksvrdmagaslllypneaavslaedllritpgngerrvwfghsgsdandcavrvlt
    aatkrsriisfigsyhgnltgsmgisghtamthtlprpgvlllpypdpfrprfsaeavle
    lldyhfatscppeqvaavfiepilsdgglvvpppaflealqdrcrkhgilvvvdevkvgl
    grtglmhcfqheglepdmvvfgkglggglplsavvgpqwvmdhapafvlqttagnpvata
    agravlntierqglaqrservggifadrlrrlsdkhsiigdvrgrglaigvdlvsdrgsr
    epapvtttakiiyrgyqlgaaftyvglnanvlefmppltltepeideaadivdqaigdvl
    dgkvadsdvahfmm