PDB entry 6gig

View 6gig on RCSB PDB site
Description: structural insights into aapa1 toxin
Deposited on 2018-05-11, released 2019-09-11
The last revision was dated 2019-12-04, with a file datestamp of 2019-11-29.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: AapA1
    Species: HELICOBACTER PYLORI, synthetic [TaxId:210]
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6gigA (A:)
matkhgknswktlylkisflgckvvvllkr