PDB entry 6gif

View 6gif on RCSB PDB site
Description: aapa1 v26a toxin from helicobacter pylori 26695
Deposited on 2018-05-11, released 2018-05-23
The last revision was dated 2019-12-04, with a file datestamp of 2019-11-29.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: AapA1
    Species: Helicobacter pylori SS1, synthetic [TaxId:102617]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A1Y3E6H1 (0-29)
      • engineered mutation (25)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6gifA (A:)
matkhgknswktlylkisflgckvvallkr