PDB entry 6gi8

View 6gi8 on RCSB PDB site
Description: Crystal structure of pentaerythritol tetranitrate reductase (PETNR) mutant L25A
Class: flavoprotein
Keywords: Mutant L25A, FLAVOPROTEIN
Deposited on 2018-05-10, released 2019-03-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-03-20, with a file datestamp of 2019-03-15.
Experiment type: XRAY
Resolution: 1.42 Å
R-factor: N/A
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pentaerythritol tetranitrate reductase
    Species: Enterobacter cloacae [TaxId:550]
    Gene: onr
    Database cross-references and differences (RAF-indexed):
    • Uniprot P71278 (Start-364)
      • conflict (25)
    Domains in SCOPe 2.07: d6gi8a_
  • Heterogens: FMN, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6gi8A (A:)
    msaeklftplkvgavtapnrvfmapatrlrsiepgdiptplmgeyyrqrasagliiseat
    qisaqakgyagapglhspeqiaawkkitagvhaedgriavqlwhtgrishssiqpggqap
    vsasalnantrtslrdengnairvdtttpraleldeipgivndfrqavanareagfdlve
    lhsahgyllhqflspssnqrtdqyggsvenrarlvlevvdavcnewsadrigirvspigt
    fqnvdngpneeadalylieelakrgiaylhmsetdlaggkpyseafrqkvrerfhgviig
    agaytaekaedligkglidavafgrdyianpdlvarlqkkaelnpqrpesfygggaegyt
    dypslhhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gi8A (A:)
    eklftplkvgavtapnrvfmapatrlrsiepgdiptplmgeyyrqrasagliiseatqis
    aqakgyagapglhspeqiaawkkitagvhaedgriavqlwhtgrishssiqpggqapvsa
    salnantrtslrdengnairvdtttpraleldeipgivndfrqavanareagfdlvelhs
    ahgyllhqflspssnqrtdqyggsvenrarlvlevvdavcnewsadrigirvspigtfqn
    vdngpneeadalylieelakrgiaylhmsetdlaggkpyseafrqkvrerfhgviigaga
    ytaekaedligkglidavafgrdyianpdlvarlqkkaelnpqrpesfygggaegytdyp
    sl