PDB entry 6gi6

View 6gi6 on RCSB PDB site
Description: Crystal structure of the ACVR1 (ALK2) kinase in complex with a Quinazolinone based ALK2 inhibitor with a 5-methyl core.
Class: signaling protein
Keywords: Kinase, BMP, inhibitor, signalling, SIGNALING PROTEIN
Deposited on 2018-05-10, released 2018-05-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-23, with a file datestamp of 2018-05-18.
Experiment type: XRAY
Resolution: 1.98 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Activin receptor type-1
    Species: Homo sapiens [TaxId:9606]
    Gene: ACVR1, ACVRLK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04771 (Start-300)
      • engineered mutation (8)
    Domains in SCOPe 2.07: d6gi6a_
  • Heterogens: EZB, SO4, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6gi6A (A:)
    smqrtvarditllecvgkgrygevwrgswqgenvavkifssrdekswfretelyntvmlr
    henilgfiasdmtsrhsstqlwlithyhemgslydylqlttldtvsclrivlsiasglah
    lhieifgtqgkpaiahrdlksknilvkkngqcciadlglavmhsqstnqldvgnnprvgt
    krymapevldetiqvdcfdsykrvdiwafglvlwevarrmvsngivedykppfydvvpnd
    psfedmrkvvcvdqqrpnipnrwfsdptltslaklmkecwyqnpsarltalrikktltki
    d
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gi6A (A:)
    rtvarditllecvgkgrygevwrgswqgenvavkifssrdekswfretelyntvmlrhen
    ilgfiasdmtsrhsstqlwlithyhemgslydylqlttldtvsclrivlsiasglahlhi
    eifgtqgkpaiahrdlksknilvkkngqcciadlglavmhsqstnqldvgnnprvgtkry
    mapevldetiqvdcfdsykrvdiwafglvlwevarrmvsngivedykppfydvvpndpsf
    edmrkvvcvdqqrpnipnrwfsdptltslaklmkecwyqnpsarltalrikktltkid