PDB entry 6ghx

View 6ghx on RCSB PDB site
Description: Alzheimer's Amyloid-Beta Peptide Fragment 31-35 in Complex with Cd-substituted Thermolysin
Class: hydrolase
Keywords: peptidase, protein-peptide complex, Hydrolase
Deposited on 2018-05-09, released 2019-02-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-06, with a file datestamp of 2019-02-01.
Experiment type: XRAY
Resolution: 1.16 Å
R-factor: N/A
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thermolysin
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ghxa_
  • Heterogens: CA, CD, DMS, ILE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6ghxA (A:)
    itgtstvgvgrgvlgdqkninttystyyylqdntrgngiftydakyrttlpgslwadadn
    qffasydapavdahyyagvtydyyknvhnrlsydgnnaairssvhysqgynnafwngsqm
    vygdgdgqtfiplsggidvvahelthavtdytagliyqnesgaineaisdifgtlvefya
    nknpdweigedvytpgisgdslrsmsdpakygdpdhyskrytgtqdnggvhinsgiinka
    aylisqggthygvsvvgigrdklgkifyraltqyltptsnfsqlraaavqsatdlygsts
    qevasvkqafdavgvk