PDB entry 6ghv

View 6ghv on RCSB PDB site
Description: Structure of a DC-SIGN CRD in complex with high affinity glycomimetic.
Class: sugar binding protein
Keywords: DC-SIGN, Inhibitor, SUGAR BINDING PROTEIN
Deposited on 2018-05-09, released 2019-09-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-09-11, with a file datestamp of 2019-09-06.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CD209 antigen
    Species: Homo sapiens [TaxId:9606]
    Gene: CD209, CLEC4L
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ghva_
  • Chain 'B':
    Compound: CD209 antigen
    Species: Homo sapiens [TaxId:9606]
    Gene: CD209, CLEC4L
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ghvb_
  • Chain 'C':
    Compound: CD209 antigen
    Species: Homo sapiens [TaxId:9606]
    Gene: CD209, CLEC4L
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ghvc_
  • Chain 'D':
    Compound: CD209 antigen
    Species: Homo sapiens [TaxId:9606]
    Gene: CD209, CLEC4L
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ghvd_
  • Chain 'E':
    Compound: CD209 antigen
    Species: Homo sapiens [TaxId:9606]
    Gene: CD209, CLEC4L
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ghve_
  • Chain 'F':
    Compound: CD209 antigen
    Species: Homo sapiens [TaxId:9606]
    Gene: CD209, CLEC4L
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ghvf_
  • Heterogens: EZ8, CA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ghvA (A:)
    erlchpcpwewtffqgncyfmsnsqrnwhdsitackevgaqlvviksaeeqnflqlqssr
    snrftwmglsdlnqegtwqwvdgspllpsfkqywnrgepnnvgeedcaefsgngwnddkc
    nlakfwickksaascsrdeeqflspapatpnpppa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ghvA (A:)
    chpcpwewtffqgncyfmsnsqrnwhdsitackevgaqlvviksaeeqnflqlqssrsnr
    ftwmglsdlnqegtwqwvdgspllpsfkqywnrgepnnvgeedcaefsgngwnddkcnla
    kfwickksaasc
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6ghvB (B:)
    erlchpcpwewtffqgncyfmsnsqrnwhdsitackevgaqlvviksaeeqnflqlqssr
    snrftwmglsdlnqegtwqwvdgspllpsfkqywnrgepnnvgeedcaefsgngwnddkc
    nlakfwickksaascsrdeeqflspapatpnpppa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ghvB (B:)
    chpcpwewtffqgncyfmsnsqrnwhdsitackevgaqlvviksaeeqnflqlqssrsnr
    ftwmglsdlnqegtwqwvdgspllpsfkqywnrgepnnvgeedcaefsgngwnddkcnla
    kfwickksaasc
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6ghvC (C:)
    erlchpcpwewtffqgncyfmsnsqrnwhdsitackevgaqlvviksaeeqnflqlqssr
    snrftwmglsdlnqegtwqwvdgspllpsfkqywnrgepnnvgeedcaefsgngwnddkc
    nlakfwickksaascsrdeeqflspapatpnpppa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ghvC (C:)
    lchpcpwewtffqgncyfmsnsqrnwhdsitackevgaqlvviksaeeqnflqlqssrsn
    rftwmglsdlnqegtwqwvdgspllpsfkqywnrgepnnvgeedcaefsgngwnddkcnl
    akfwickksaasc
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6ghvD (D:)
    erlchpcpwewtffqgncyfmsnsqrnwhdsitackevgaqlvviksaeeqnflqlqssr
    snrftwmglsdlnqegtwqwvdgspllpsfkqywnrgepnnvgeedcaefsgngwnddkc
    nlakfwickksaascsrdeeqflspapatpnpppa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ghvD (D:)
    lchpcpwewtffqgncyfmsnsqrnwhdsitackevgaqlvviksaeeqnflqlqssrsn
    rftwmglsdlnqegtwqwvdgspllpsfkqywnrgepnnvgeedcaefsgngwnddkcnl
    akfwickksaasc
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6ghvE (E:)
    erlchpcpwewtffqgncyfmsnsqrnwhdsitackevgaqlvviksaeeqnflqlqssr
    snrftwmglsdlnqegtwqwvdgspllpsfkqywnrgepnnvgeedcaefsgngwnddkc
    nlakfwickksaascsrdeeqflspapatpnpppa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ghvE (E:)
    lchpcpwewtffqgncyfmsnsqrnwhdsitackevgaqlvviksaeeqnflqlqssrsn
    rftwmglsdlnqegtwqwvdgspllpsfkqywnrgepnnvgeedcaefsgngwnddkcnl
    akfwickksaasc
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6ghvF (F:)
    erlchpcpwewtffqgncyfmsnsqrnwhdsitackevgaqlvviksaeeqnflqlqssr
    snrftwmglsdlnqegtwqwvdgspllpsfkqywnrgepnnvgeedcaefsgngwnddkc
    nlakfwickksaascsrdeeqflspapatpnpppa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ghvF (F:)
    chpcpwewtffqgncyfmsnsqrnwhdsitackevgaqlvviksaeeqnflqlqssrsnr
    ftwmglsdlnqegtwqwvdgspllpsfkqywnrgepnnvgeedcaefsgngwnddkcnla
    kfwickksaasc