PDB entry 6ghr

View 6ghr on RCSB PDB site
Description: cyanobacterial gapdh with full-length cp12
Deposited on 2018-05-08, released 2019-05-08
The last revision was dated 2019-11-20, with a file datestamp of 2019-11-15.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glyceraldehyde-3-phosphate dehydrogenase
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Gene: tll1466
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8DIW5 (17-353)
      • expression tag (16)
  • Chain 'B':
    Compound: glyceraldehyde-3-phosphate dehydrogenase
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Gene: tll1466
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8DIW5 (17-353)
      • expression tag (12-16)
  • Chain 'C':
    Compound: glyceraldehyde-3-phosphate dehydrogenase
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Gene: tll1466
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8DIW5 (17-353)
      • expression tag (16)
  • Chain 'D':
    Compound: glyceraldehyde-3-phosphate dehydrogenase
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Gene: tll1466
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8DIW5 (17-353)
      • expression tag (16)
  • Chain 'E':
    Compound: cp12 polypeptide
    Species: Thermosynechococcus elongatus BP-1 [TaxId:197221]
    Gene: cp12
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: cp12 polypeptide
    Species: Thermosynechococcus elongatus BP-1 [TaxId:197221]
    Gene: cp12
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NAD, SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6ghrA (A:)
    mrgshhhhhhglvprgsmvrvaingfgrigrnfmrcwlqrkanskleivgindtsdprtn
    ahllkydsmlgifqdaeitadddciyagghavkcvsdrnpenlpwsawgidlvieatgvf
    tsregaskhlsagakkvlitapgkgniptyvvgvnhhtydpsedivsnascttnclapiv
    kvlheafgiqqgmmttthsytgdqrlldashrdlrraraaamnivptstgaakavglvip
    elqgklngialrvptpnvsvvdfvaqvekptiaeqvnqvikeasettmkgiihyselelv
    ssdyrghnassildasltmvlggnlvkvvawydnewgysqrvldlaehmaahwa
    

    Sequence, based on observed residues (ATOM records):
    >6ghrA (A:)
    smvrvaingfgrigrnfmrcwlqrkanskleivgindtsdprtnahllkydsmlgifqda
    eitadddciyagghavkcvsdrnpenlpwsawgidlvieatgvftsregaskhlsagakk
    vlitapgkgniptyvvgvnhhtydpsedivsnascttnclapivkvlheafgiqqgmmtt
    thsytgdqrlldashrdlrraraaamnivptstgaakavglvipelqgklngialrvptp
    nvsvvdfvaqvekptiaeqvnqvikeasettmkgiihyselelvssdyrghnassildas
    ltmvlggnlvkvvawydnewgysqrvldlaehmaahwa
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6ghrB (B:)
    mrgshhhhhhglvprgsmvrvaingfgrigrnfmrcwlqrkanskleivgindtsdprtn
    ahllkydsmlgifqdaeitadddciyagghavkcvsdrnpenlpwsawgidlvieatgvf
    tsregaskhlsagakkvlitapgkgniptyvvgvnhhtydpsedivsnascttnclapiv
    kvlheafgiqqgmmttthsytgdqrlldashrdlrraraaamnivptstgaakavglvip
    elqgklngialrvptpnvsvvdfvaqvekptiaeqvnqvikeasettmkgiihyselelv
    ssdyrghnassildasltmvlggnlvkvvawydnewgysqrvldlaehmaahwa
    

    Sequence, based on observed residues (ATOM records):
    >6ghrB (B:)
    vprgsmvrvaingfgrigrnfmrcwlqrkanskleivgindtsdprtnahllkydsmlgi
    fqdaeitadddciyagghavkcvsdrnpenlpwsawgidlvieatgvftsregaskhlsa
    gakkvlitapgkgniptyvvgvnhhtydpsedivsnascttnclapivkvlheafgiqqg
    mmttthsytgdqrlldashrdlrraraaamnivptstgaakavglvipelqgklngialr
    vptpnvsvvdfvaqvekptiaeqvnqvikeasettmkgiihyselelvssdyrghnassi
    ldasltmvlggnlvkvvawydnewgysqrvldlaehmaahwa
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >6ghrC (C:)
    mrgshhhhhhglvprgsmvrvaingfgrigrnfmrcwlqrkanskleivgindtsdprtn
    ahllkydsmlgifqdaeitadddciyagghavkcvsdrnpenlpwsawgidlvieatgvf
    tsregaskhlsagakkvlitapgkgniptyvvgvnhhtydpsedivsnascttnclapiv
    kvlheafgiqqgmmttthsytgdqrlldashrdlrraraaamnivptstgaakavglvip
    elqgklngialrvptpnvsvvdfvaqvekptiaeqvnqvikeasettmkgiihyselelv
    ssdyrghnassildasltmvlggnlvkvvawydnewgysqrvldlaehmaahwa
    

    Sequence, based on observed residues (ATOM records):
    >6ghrC (C:)
    smvrvaingfgrigrnfmrcwlqrkanskleivgindtsdprtnahllkydsmlgifqda
    eitadddciyagghavkcvsdrnpenlpwsawgidlvieatgvftsregaskhlsagakk
    vlitapgkgniptyvvgvnhhtydpsedivsnascttnclapivkvlheafgiqqgmmtt
    thsytgdqrlldashrdlrraraaamnivptstgaakavglvipelqgklngialrvptp
    nvsvvdfvaqvekptiaeqvnqvikeasettmkgiihyselelvssdyrghnassildas
    ltmvlggnlvkvvawydnewgysqrvldlaehmaahwa
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >6ghrD (D:)
    mrgshhhhhhglvprgsmvrvaingfgrigrnfmrcwlqrkanskleivgindtsdprtn
    ahllkydsmlgifqdaeitadddciyagghavkcvsdrnpenlpwsawgidlvieatgvf
    tsregaskhlsagakkvlitapgkgniptyvvgvnhhtydpsedivsnascttnclapiv
    kvlheafgiqqgmmttthsytgdqrlldashrdlrraraaamnivptstgaakavglvip
    elqgklngialrvptpnvsvvdfvaqvekptiaeqvnqvikeasettmkgiihyselelv
    ssdyrghnassildasltmvlggnlvkvvawydnewgysqrvldlaehmaahwa
    

    Sequence, based on observed residues (ATOM records):
    >6ghrD (D:)
    smvrvaingfgrigrnfmrcwlqrkanskleivgindtsdprtnahllkydsmlgifqda
    eitadddciyagghavkcvsdrnpenlpwsawgidlvieatgvftsregaskhlsagakk
    vlitapgkgniptyvvgvnhhtydpsedivsnascttnclapivkvlheafgiqqgmmtt
    thsytgdqrlldashrdlrraraaamnivptstgaakavglvipelqgklngialrvptp
    nvsvvdfvaqvekptiaeqvnqvikeasettmkgiihyselelvssdyrghnassildas
    ltmvlggnlvkvvawydnewgysqrvldlaehmaahwa
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >6ghrE (E:)
    gsmsnlekqieqareeahkicdtegatsgqcaaawdaleelqaeaahqraeqqdhktsfq
    qycddnpdaaecriydd
    

    Sequence, based on observed residues (ATOM records):
    >6ghrE (E:)
    tsfqqycddnpdaaecriydd
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >6ghrF (F:)
    gsmsnlekqieqareeahkicdtegatsgqcaaawdaleelqaeaahqraeqqdhktsfq
    qycddnpdaaecriydd
    

    Sequence, based on observed residues (ATOM records):
    >6ghrF (F:)
    msnlekqieqareeahkicdgqcaaawdaleelqaeaahqraeqqdhktsfqqycddnpd
    aaecriydd