PDB entry 6gho

View 6gho on RCSB PDB site
Description: Crystal structure of Spx in complex with YjbH
Class: protein binding
Keywords: Regulatory protein spx Adaptor protein YjbH, PROTEIN BINDING
Deposited on 2018-05-08, released 2019-04-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-06-19, with a file datestamp of 2019-06-14.
Experiment type: XRAY
Resolution: 1.79 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Regulatory protein spx
    Species: BACILLUS SUBTILIS SUBSP. SUBTILIS STR. 168 [TaxId:224308]
    Gene: spxA, yjbD, BSU11500
    Database cross-references and differences (RAF-indexed):
    • Uniprot O31602 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.08: d6ghoa1, d6ghoa2
  • Chain 'B':
    Compound: UPF0413 protein GK0824
    Species: GEOBACILLUS KAUSTOPHILUS HTA426 [TaxId:235909]
    Gene: GK0824
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ghoA (A:)
    smvtlytspsctscrkarawleeheipfvernifseplsideikqilrmtedgtdeiist
    rskvfqklnvnvesmplqdlyrlinehpgllrrpiiidekrlqvgynedeirrflprkvr
    sfqlreaqrlan
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ghoA (A:)
    smvtlytspsctscrkarawleeheipfvernifseplsideikqilrmtedgtdeiist
    rskvfqklnvnvesmplqdlyrlinehpgllrrpiiidekrlqvgynedeirrflprkvr
    sfqlre
    

  • Chain 'B':
    No sequence available.