PDB entry 6ghm

View 6ghm on RCSB PDB site
Description: Structure of PP1 alpha phosphatase bound to ASPP2
Class: hydrolase
Keywords: Phosphatase, PP1, ASPP2, HYDROLASE
Deposited on 2018-05-08, released 2019-02-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-27, with a file datestamp of 2019-02-22.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein phosphatase PP1-alpha catalytic subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: PPP1CA, PPP1A
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Serine/threonine-protein phosphatase PP1-alpha catalytic subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: PPP1CA, PPP1A
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: apoptosis-stimulating of p53 protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: TP53BP2, ASPP2, BBP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ghmc1, d6ghmc2
  • Chain 'D':
    Compound: apoptosis-stimulating of p53 protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: TP53BP2, ASPP2, BBP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ghmd1, d6ghmd2
  • Heterogens: EDO, GOL, NHE, MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6ghmC (C:)
    gplgsmrvkfnplallldsslegefdlvqriiyevddpslpndegitalhnavcaghtei
    vkflvqfgvnvnaadsdgwtplhcaascnnvqvckflvesgaavfamtysdmqtaadkce
    emeegytqcsqflygvqekmgimnkgviyalwdyepqnddelpmkegdcmtiihredede
    iewwwarlndkegyvprnllglyprikprqrsla
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ghmC (C:)
    mrvkfnplallldsslegefdlvqriiyevddpslpndegitalhnavcaghteivkflv
    qfgvnvnaadsdgwtplhcaascnnvqvckflvesgaavfamtysdmqtaadkceemeeg
    ytqcsqflygvqekmgimnkgviyalwdyepqnddelpmkegdcmtiihrededeiewww
    arlndkegyvprnllglyprik
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6ghmD (D:)
    gplgsmrvkfnplallldsslegefdlvqriiyevddpslpndegitalhnavcaghtei
    vkflvqfgvnvnaadsdgwtplhcaascnnvqvckflvesgaavfamtysdmqtaadkce
    emeegytqcsqflygvqekmgimnkgviyalwdyepqnddelpmkegdcmtiihredede
    iewwwarlndkegyvprnllglyprikprqrsla
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ghmD (D:)
    mrvkfnplallldsslegefdlvqriiyevddpslpndegitalhnavcaghteivkflv
    qfgvnvnaadsdgwtplhcaascnnvqvckflvesgaavfamtysdmqtaadkceemeeg
    ytqcsqflygvqekmgimnkgviyalwdyepqnddelpmkegdcmtiihrededeiewww
    arlndkegyvprnllglyprikp