PDB entry 6ggz

View 6ggz on RCSB PDB site
Description: nmr structure of the scorpion toxin ammtx3
Deposited on 2018-05-04, released 2019-01-30
The last revision was dated 2020-03-11, with a file datestamp of 2020-03-06.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: Potassium channel toxin alpha-KTx 15.3
    Species: Androctonus mauritanicus mauritanicus, synthetic [TaxId:6860]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P60208 (0-36)
      • conflict (0)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain '1':
    Sequence; same for both SEQRES and ATOM records:
    >6ggz1 (1:)
eietnkkcqggscasvcrkvigvaagkcingrcvcyp