PDB entry 6ggu

View 6ggu on RCSB PDB site
Description: Crystal structure of native FE-hydrogenase from Methanothermobacter marburgensis
Class: oxidoreductase
Keywords: [Fe]-hydrogenase, Fe-Guanylylpyridinol cofactor, H2, hydrogenase, methanogenesis, methenyl-tetrahydromethanopterin, methylene-tetrahydromethanopterin, hydrogenation, oligomerisation, protection, metalloenzyme, OXIDOREDUCTASE
Deposited on 2018-05-03, released 2019-05-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-05-22, with a file datestamp of 2019-05-17.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5,10-methenyltetrahydromethanopterin hydrogenase
    Species: Methanothermobacter marburgensis str. Marburg [TaxId:79929]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ggua1, d6ggua2
  • Heterogens: MES, SO4, FE9, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6gguA (A:)
    mklailgagcyrthaasgitnfsracevaemvgkpeiamthstitmgaelkelagvdevv
    vadpvfdnqftviddfayedvieahkedpekimpqirekvnevakelpkppegaihfthp
    edlgfeittddreavadadfimtwfpkgdmqpdiinkfiddikpgaivthactipttkfy
    kifeqkhgdlvtkpetlnvtsyhpgavpemkgqvyiaegyasedaietlfelgqkargna
    yrlpaellgpvcdmcsaltaityagilsyrdsvtqvlgapasfaqmmakesleqitalme
    kvgidkmeenldpgallgtadsmnfgasaeilptvfeilekrkk