PDB entry 6ggr

View 6ggr on RCSB PDB site
Description: Crystal structure of Salmonella zinc metalloprotease effector GtgA in complex with p65
Class: metal binding protein
Keywords: Protease, Metalloprotease, zinc, METAL BINDING PROTEIN
Deposited on 2018-05-03, released 2018-08-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-10-10, with a file datestamp of 2018-10-05.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcription factor p65
    Species: Mus musculus [TaxId:10090]
    Gene: Rela, Nfkb3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04207 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.08: d6ggra1, d6ggra2
  • Chain 'B':
    Compound: Bacteriophage virulence determinant
    Species: Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S [TaxId:588858]
    Gene: gtgA, STM14_1166
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >6ggrA (A:)
ayveiieqpkqrgmrfrykcegrsagsipgerstdttkthptikingytgpgtvrislvt
kdpphrphphelvgkdcrdgyyeadlcpdrsihsfqnlgiqcvkkrdleqaisqriqtnn
npfhvpieeqrgdydlnavrlcfqvtvrdpagrpllltpvlshpifdnra

    Sequence, based on observed residues (ATOM records): (download) 
    >6ggrA (A:)
ayveiieqpkqrgmrfrykcegrsagsipgerstdttkthptikingytgpgtvrislvt
kdpphrphphelvgkdcrdgyyeadlcpdrsihsfqnlgiqcvkkrdleqaisqriqtnn
npfhvpieeqrgdydlnavrlcfqvtvrdpagrpllltpvlshpifdn

  • Chain 'B':
    No sequence available.