PDB entry 6ggo

View 6ggo on RCSB PDB site
Description: crystal structure of salmonella zinc metalloprotease effector gtga
Deposited on 2018-05-03, released 2018-08-29
The last revision was dated 2018-10-10, with a file datestamp of 2018-10-05.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bacteriophage virulence determinant
    Species: Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S [TaxId:588858]
    Gene: gtgA, STM14_1166
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Bacteriophage virulence determinant
    Species: Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S [TaxId:588858]
    Gene: gtgA, STM14_1166
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN, CL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6ggoA (A:)
    gamshphdskvfpdlpehqdnpsqlrlqhdglatddkarlepmclaeylisgpggmdpdi
    eidddtydecrevlsriledaytqsgtfrrlmnyaydqelhdveqrwllgagenfgttvt
    dedlessegrkvialnlddtdddsipeyyesndgpqqfdttrsfihqvvhalthlqdked
    snprgpvveytniilkemghtsppriayefsn
    

    Sequence, based on observed residues (ATOM records):
    >6ggoA (A:)
    skvfpdlpehqdnpsqlrlqhdglatddkarlepmclaeylisgpggmdpdieidddtyd
    ecrevlsriledaytqsgtfrrlmnyaydqelhdveqrwllgagenfgttvtdedlesse
    grkvialnlddsipeyyesndgpqqfdttrsfihqvvhalthlqdkedsnprgpvveytn
    iilkemghtsppriayefs
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6ggoB (B:)
    gamshphdskvfpdlpehqdnpsqlrlqhdglatddkarlepmclaeylisgpggmdpdi
    eidddtydecrevlsriledaytqsgtfrrlmnyaydqelhdveqrwllgagenfgttvt
    dedlessegrkvialnlddtdddsipeyyesndgpqqfdttrsfihqvvhalthlqdked
    snprgpvveytniilkemghtsppriayefsn
    

    Sequence, based on observed residues (ATOM records):
    >6ggoB (B:)
    vfpdlpehqdnpsqlrlqhdglatddkarlepmclaeylisgpggmdpdieidddtydec
    revlsriledaytqsgtfrrlmnyaydqelhdveqrwllgagenfgttvtdedlessegr
    kvialnlddtsipeyyesndgpqqfdttrsfihqvvhalthlqdkedsnprgpvveytni
    ilkemghtsppriayefs