PDB entry 6ggb

View 6ggb on RCSB PDB site
Description: p53 cancer mutant Y220C in complex with small-molecule stabilizer PK9318
Class: DNA binding protein
Keywords: p53, transcription factor, tumor supressor, cancer therapy, oncogenic mutant, protein misfolding, small-molecule stabilizer, molecular chaperone, DNA BINDING PROTEIN
Deposited on 2018-05-03, released 2019-05-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-05-22, with a file datestamp of 2019-05-17.
Experiment type: XRAY
Resolution: 1.32 Å
R-factor: N/A
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cellular tumor antigen p53
    Species: Homo sapiens [TaxId:9606]
    Gene: TP53, P53
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04637
      • engineered mutation (39)
      • engineered mutation (109)
      • engineered mutation (126)
      • engineered mutation (145)
      • engineered mutation (174)
    Domains in SCOPe 2.07: d6ggba_
  • Chain 'B':
    Compound: Cellular tumor antigen p53
    Species: Homo sapiens [TaxId:9606]
    Gene: TP53, P53
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04637 (0-End)
      • engineered mutation (39)
      • engineered mutation (109)
      • engineered mutation (126)
      • engineered mutation (145)
      • engineered mutation (174)
    Domains in SCOPe 2.07: d6ggbb_
  • Heterogens: ZN, EXQ, EDO, GOL, EPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ggbA (A:)
    sssvpsqktyqgsygfrlgflhsgtaksvtctyspalnklfcqlaktcpvqlwvdstppp
    gtrvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlraeylddrntfr
    hsvvvpceppevgsdcttihynymcysscmggmnrrpiltiitledssgnllgrdsfevr
    vcacpgrdrrteeenlrkkgephhelppgstkralpnnt
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ggbA (A:)
    ssvpsqktyqgsygfrlgflhsgtaksvtctyspalnklfcqlaktcpvqlwvdstpppg
    trvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlraeylddrntfrh
    svvvpceppevgsdcttihynymcysscmggmnrrpiltiitledssgnllgrdsfevrv
    cacpgrdrrteeenlrkk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6ggbB (B:)
    sssvpsqktyqgsygfrlgflhsgtaksvtctyspalnklfcqlaktcpvqlwvdstppp
    gtrvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlraeylddrntfr
    hsvvvpceppevgsdcttihynymcysscmggmnrrpiltiitledssgnllgrdsfevr
    vcacpgrdrrteeenlrkkgephhelppgstkralpnnt
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ggbB (B:)
    sssvpsqktyqgsygfrlgflhsgtaksvtctyspalnklfcqlaktcpvqlwvdstppp
    gtrvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlraeylddrntfr
    hsvvvpceppevgsdcttihynymcysscmggmnrrpiltiitledssgnllgrdsfevr
    vcacpgrdrrteeenlrk