PDB entry 6gg8

View 6gg8 on RCSB PDB site
Description: Mineralocorticoid receptor in complex with (s)-13
Class: transcription
Keywords: Mineralocorticoid receptor, nuclear hormone receptor, steroid receptor, ligand complex, peptide complex, signaling protein, TRANSCRIPTION
Deposited on 2018-05-03, released 2019-01-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-09, with a file datestamp of 2019-01-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mineralocorticoid receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: NR3C2, MCR, MLR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08235 (Start-271)
      • conflict (95)
      • conflict (197)
    Domains in SCOPe 2.07: d6gg8a_
  • Chain 'B':
    Compound: Nuclear receptor coactivator 1
    Species: Homo sapiens [TaxId:9606]
    Gene: NCOA1, BHLHE74, SRC1
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MPD, EY8, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6gg8A (A:)
    mhnhnhnhnhnhnggenlyfqgtpspvmvleniepeivyagydsskpdtaenllstlnrl
    agkqmiqvvkwakvlpgfknlpledqitliqyswmslssfalswrsykhtnsqflyfapd
    lvfneekmhqsamyelcqgmhqislqfvrlqltfeeytimkvllllstipkdglksqaaf
    eemrtnyikelrkmvtkspnnsgqswqrfyqltklldsmhdlvsdllefcfytfreshal
    kvefpamlveiisdqlpkvesgnakplyfhrkggslvprgsgggsggsggpqaqqksllq
    qllte
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gg8A (A:)
    spvmvleniepeivyagydsskpdtaenllstlnrlagkqmiqvvkwakvlpgfknlple
    dqitliqyswmslssfalswrsykhtnsqflyfapdlvfneekmhqsamyelcqgmhqis
    lqfvrlqltfeeytimkvllllstipkdglksqaafeemrtnyikelrkmvtksswqrfy
    qltklldsmhdlvsdllefcfytfreshalkvefpamlveiisdqlpkvesgnakplyfh
    rk
    

  • Chain 'B':
    No sequence available.