PDB entry 6gg5

View 6gg5 on RCSB PDB site
Description: crystal structure of m2 pyk in complex with tryptophan.
Deposited on 2018-05-02, released 2018-05-23
The last revision was dated 2018-06-13, with a file datestamp of 2018-06-08.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pyruvate kinase PKM
    Species: Homo sapiens [TaxId:9606]
    Gene: PKM, OIP3, PK2, PK3, PKM2
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Pyruvate kinase PKM
    Species: Homo sapiens [TaxId:9606]
    Gene: PKM, OIP3, PK2, PK3, PKM2
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Pyruvate kinase PKM
    Species: Homo sapiens [TaxId:9606]
    Gene: PKM, OIP3, PK2, PK3, PKM2
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Pyruvate kinase PKM
    Species: Homo sapiens [TaxId:9606]
    Gene: PKM, OIP3, PK2, PK3, PKM2
    Database cross-references and differences (RAF-indexed):
  • Heterogens: PO4, TRP, K, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6gg5A (A:)
    mgsshhhhhhssglvprgshmskphseagtafiqtqqlhaamadtflehmcrldidsppi
    tarntgiictigpasrsvetlkemiksgmnvarlnfshgtheyhaetiknvrtatesfas
    dpilyrpvavaldtkgpeirtglikgsgtaevelkkgatlkitldnaymekcdenilwld
    yknickvvevgskiyvddglislqvkqkgadflvtevenggslgskkgvnlpgaavdlpa
    vsekdiqdlkfgveqdvdmvfasfirkasdvhevrkvlgekgknikiiskienhegvrrf
    deileasdgimvargdlgieipaekvflaqkmmigrcnragkpvicatqmlesmikkprp
    traegsdvanavldgadcimlsgetakgdypleavrmqhliareaeaaiyhlqlfeelrr
    lapitsdpteatavgaveasfkccsgaiivltksgrsahqvaryrprapiiavtrnpqta
    rqahlyrgifpvlckdpvqeawaedvdlrvnfamnvgkargffkkgdvvivltgwrpgsg
    ftntmrvvpvp
    

    Sequence, based on observed residues (ATOM records):
    >6gg5A (A:)
    adtflehmcrldidsppitarntgiictigpasrsvetlkemiksgmnvarlnfshgthe
    yhaetiknvrtatesfasdpilyrpvavaldtkgpeirtglikgsgtaevelkkgatlki
    tldnaymekcdenilwldyknickvvevgskiyvddglislqvkqkgadflvtevenggs
    lgskkgvnlpgaavdlpavsekdiqdlkfgveqdvdmvfasfirkasdvhevrkvlgekg
    knikiiskienhegvrrfdeileasdgimvargdlgieipaekvflaqkmmigrcnragk
    pvicatqmlesmikkprptraegsdvanavldgadcimlsgetakgdypleavrmqhlia
    reaeaaiyhlqlfeelrrlapitsdpteatavgaveasfkccsgaiivltksgrsahqva
    ryrprapiiavtrnpqtarqahlyrgifpvlckdpvqeawaedvdlrvnfamnvgkargf
    fkkgdvvivltgwrpgsgftntmrvvpvp
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6gg5B (B:)
    mgsshhhhhhssglvprgshmskphseagtafiqtqqlhaamadtflehmcrldidsppi
    tarntgiictigpasrsvetlkemiksgmnvarlnfshgtheyhaetiknvrtatesfas
    dpilyrpvavaldtkgpeirtglikgsgtaevelkkgatlkitldnaymekcdenilwld
    yknickvvevgskiyvddglislqvkqkgadflvtevenggslgskkgvnlpgaavdlpa
    vsekdiqdlkfgveqdvdmvfasfirkasdvhevrkvlgekgknikiiskienhegvrrf
    deileasdgimvargdlgieipaekvflaqkmmigrcnragkpvicatqmlesmikkprp
    traegsdvanavldgadcimlsgetakgdypleavrmqhliareaeaaiyhlqlfeelrr
    lapitsdpteatavgaveasfkccsgaiivltksgrsahqvaryrprapiiavtrnpqta
    rqahlyrgifpvlckdpvqeawaedvdlrvnfamnvgkargffkkgdvvivltgwrpgsg
    ftntmrvvpvp
    

    Sequence, based on observed residues (ATOM records):
    >6gg5B (B:)
    adtflehmcrldidsppitarntgiictigpasrsvetlkemiksgmnvarlnfshgthe
    yhaetiknvrtatesfasdpilyrpvavaldtkgpeirtglikgsgtaevelkkgatlki
    tldnaymekcdenilwldyknickvvevgskiyvddglislqvkqkgadflvtevenggs
    lgskkgvnlpgaavdlpavsekdiqdlkfgveqdvdmvfasfirkasdvhevrkvlgekg
    knikiiskienhegvrrfdeileasdgimvargdlgieipaekvflaqkmmigrcnragk
    pvicatqmlesmikkprptraegsdvanavldgadcimlsgetakgdypleavrmqhlia
    reaeaaiyhlqlfeelrrlapitsdpteatavgaveasfkccsgaiivltksgrsahqva
    ryrprapiiavtrnpqtarqahlyrgifpvlckdpvqeawaedvdlrvnfamnvgkargf
    fkkgdvvivltgwrpgsgftntmrvvpvp
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >6gg5C (C:)
    mgsshhhhhhssglvprgshmskphseagtafiqtqqlhaamadtflehmcrldidsppi
    tarntgiictigpasrsvetlkemiksgmnvarlnfshgtheyhaetiknvrtatesfas
    dpilyrpvavaldtkgpeirtglikgsgtaevelkkgatlkitldnaymekcdenilwld
    yknickvvevgskiyvddglislqvkqkgadflvtevenggslgskkgvnlpgaavdlpa
    vsekdiqdlkfgveqdvdmvfasfirkasdvhevrkvlgekgknikiiskienhegvrrf
    deileasdgimvargdlgieipaekvflaqkmmigrcnragkpvicatqmlesmikkprp
    traegsdvanavldgadcimlsgetakgdypleavrmqhliareaeaaiyhlqlfeelrr
    lapitsdpteatavgaveasfkccsgaiivltksgrsahqvaryrprapiiavtrnpqta
    rqahlyrgifpvlckdpvqeawaedvdlrvnfamnvgkargffkkgdvvivltgwrpgsg
    ftntmrvvpvp
    

    Sequence, based on observed residues (ATOM records):
    >6gg5C (C:)
    adtflehmcrldidsppitarntgiictigpasrsvetlkemiksgmnvarlnfshgthe
    yhaetiknvrtatesfasdpilyrpvavaldtkgpelpavsekdiqdlkfgveqdvdmvf
    asfirkasdvhevrkvlgekgknikiiskienhegvrrfdeileasdgimvargdlgiei
    paekvflaqkmmigrcnragkpvicatqmlesmikkprptraegsdvanavldgadciml
    sgetakgdypleavrmqhliareaeaaiyhlqlfeelrrlapitsdpteatavgaveasf
    kccsgaiivltksgrsahqvaryrprapiiavtrnpqtarqahlyrgifpvlckdpvqea
    waedvdlrvnfamnvgkargffkkgdvvivltgwrpgsgftntmrvvpvp
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >6gg5D (D:)
    mgsshhhhhhssglvprgshmskphseagtafiqtqqlhaamadtflehmcrldidsppi
    tarntgiictigpasrsvetlkemiksgmnvarlnfshgtheyhaetiknvrtatesfas
    dpilyrpvavaldtkgpeirtglikgsgtaevelkkgatlkitldnaymekcdenilwld
    yknickvvevgskiyvddglislqvkqkgadflvtevenggslgskkgvnlpgaavdlpa
    vsekdiqdlkfgveqdvdmvfasfirkasdvhevrkvlgekgknikiiskienhegvrrf
    deileasdgimvargdlgieipaekvflaqkmmigrcnragkpvicatqmlesmikkprp
    traegsdvanavldgadcimlsgetakgdypleavrmqhliareaeaaiyhlqlfeelrr
    lapitsdpteatavgaveasfkccsgaiivltksgrsahqvaryrprapiiavtrnpqta
    rqahlyrgifpvlckdpvqeawaedvdlrvnfamnvgkargffkkgdvvivltgwrpgsg
    ftntmrvvpvp
    

    Sequence, based on observed residues (ATOM records):
    >6gg5D (D:)
    adtflehmcrldidsppitarntgiictigpasrsvetlkemiksgmnvarlnfshgthe
    yhaetiknvrtatesfasdpilyrpvavaldtkgpelpavsekdiqdlkfgveqdvdmvf
    asfirkasdvhevrkvlgekgknikiiskienhegvrrfdeileasdgimvargdlgiei
    paekvflaqkmmigrcnragkpvicatqmlesmikkprptraegsdvanavldgadciml
    sgetakgdypleavrmqhliareaeaaiyhlqlfeelrrlapitsdpteatavgaveasf
    kccsgaiivltksgrsahqvaryrprapiiavtrnpqtarqahlyrgifpvlckdpvqea
    waedvdlrvnfamnvgkargffkkgdvvivltgwrpgsgftntmrvvpvp