PDB entry 6gft

View 6gft on RCSB PDB site
Description: Antinociceptive evaluation of cyriotoxin-1a, the first toxin purified from Cyriopagopus schioedtei spider venom
Class: toxin
Keywords: Toxine, Spider Venom, Cyriopagopus schioedtei, TOXIN
Deposited on 2018-05-02, released 2019-03-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cyriotoxin-1a
  Species: Cyriopagopus schioedtei [TaxId:1046902]
  Database cross-references and differences (RAF-indexed):
  • PDB 6GFT (0-32)
  Domains in SCOPe 2.08: d6gfta_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6gftA (A:)
  eckgfgkscvpgkneccsgltcsnkhkwckvll