PDB entry 6gft

View 6gft on RCSB PDB site
Description: Antinociceptive evaluation of cyriotoxin-1a, the first toxin purified from Cyriopagopus schioedtei spider venom
Class: toxin
Keywords: Toxine, Spider Venom, Cyriopagopus schioedtei, TOXIN
Deposited on 2018-05-02, released 2019-03-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-03-06, with a file datestamp of 2019-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyriotoxin-1a
    Species: Cyriopagopus schioedtei [TaxId:1046902]
    Database cross-references and differences (RAF-indexed):
    • PDB 6GFT (0-32)
    Domains in SCOPe 2.07: d6gfta_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6gftA (A:)
    eckgfgkscvpgkneccsgltcsnkhkwckvll