PDB entry 6gfs

View 6gfs on RCSB PDB site
Description: Thermodynamic, Crystallographic and Computational Studies of Non Mammalian Fatty Acid Binding to Bovine b-Lactoglobulin
Class: transport protein
Keywords: lactoglobulin, fatty acid, Non-Mammalian, transport protein
Deposited on 2018-05-02, released 2018-06-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-07-11, with a file datestamp of 2018-07-06.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-lactoglobulin
    Species: Bos taurus [TaxId:9913]
    Gene: LGB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6gfsa_
  • Heterogens: F15, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6gfsA (A:)
    livtqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqk
    wengecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslacq
    clvrtpevddealekfdkalkalpmhirlsfnptqleeqchi