PDB entry 6gff

View 6gff on RCSB PDB site
Description: Structure of GARP (LRRC32) in complex with latent TGF-beta1 and MHG-8 Fab
Class: immune system
Keywords: GARP, TGF-B1, Activation, Treg, IMMUNE SYSTEM
Deposited on 2018-04-30, released 2018-11-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-07, with a file datestamp of 2018-11-02.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transforming growth factor beta-1
    Species: Homo sapiens [TaxId:9606]
    Gene: TGFB1, TGFB
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Transforming growth factor beta-1
    Species: Homo sapiens [TaxId:9606]
    Gene: TGFB1, TGFB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gffb_
  • Chain 'C':
    Compound: Transforming growth factor beta-1
    Species: Homo sapiens [TaxId:9606]
    Gene: TGFB1, TGFB
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Transforming growth factor beta-1
    Species: Homo sapiens [TaxId:9606]
    Gene: TGFB1, TGFB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gffd_
  • Chain 'E':
    Compound: Transforming growth factor beta-1
    Species: Homo sapiens [TaxId:9606]
    Gene: TGFB1, TGFB
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Transforming growth factor beta-1
    Species: Homo sapiens [TaxId:9606]
    Gene: TGFB1, TGFB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gfff_
  • Chain 'G':
    Compound: Transforming growth factor beta-1
    Species: Homo sapiens [TaxId:9606]
    Gene: TGFB1, TGFB
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Transforming growth factor beta-1
    Species: Homo sapiens [TaxId:9606]
    Gene: TGFB1, TGFB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gffh_
  • Chain 'I':
    Compound: Leucine-rich repeat-containing protein 32
    Species: Homo sapiens [TaxId:9606]
    Gene: LRRC32, D11S833E, GARP
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: Leucine-rich repeat-containing protein 32
    Species: Homo sapiens [TaxId:9606]
    Gene: LRRC32, D11S833E, GARP
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: MHG-8 Fab light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6GFF (0-211)
    Domains in SCOPe 2.07: d6gffk1, d6gffk2
  • Chain 'L':
    Compound: MHG-8 Fab heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6GFF (0-220)
  • Chain 'M':
    Compound: MHG-8 Fab light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6GFF (0-End)
    Domains in SCOPe 2.07: d6gffm_
  • Chain 'N':
    Compound: MHG-8 Fab heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6GFF (0-End)
  • Heterogens: NAG, BMA, MAN

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6gffB (B:)
    aldtnycfssteknccvrqlyidfrkdlgwkwihepkgyhanfclgpcpyiwsldtqysk
    vlalynqhnpgasaapccvpqaleplpivyyvgrkpkveqlsnmivrsckcs
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6gffD (D:)
    aldtnycfssteknccvrqlyidfrkdlgwkwihepkgyhanfclgpcpyiwsldtqysk
    vlalynqhnpgasaapccvpqaleplpivyyvgrkpkveqlsnmivrsckcs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gffD (D:)
    ldtnycfssteknccvrqlyidfrkdlgwkwihepkgyhanfclgpcpyiwsldtqyskv
    lalynqhnpgasaapccvpqaleplpivyyvgrkpkveqlsnmivrsckcs
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6gffF (F:)
    aldtnycfssteknccvrqlyidfrkdlgwkwihepkgyhanfclgpcpyiwsldtqysk
    vlalynqhnpgasaapccvpqaleplpivyyvgrkpkveqlsnmivrsckcs
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6gffH (H:)
    aldtnycfssteknccvrqlyidfrkdlgwkwihepkgyhanfclgpcpyiwsldtqysk
    vlalynqhnpgasaapccvpqaleplpivyyvgrkpkveqlsnmivrsckcs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gffH (H:)
    tnycfssteknccvrqlyidfrkdlgwkwihepkgyhanfclgpcpyiwsldtqyskvla
    lynqhnpgasaapccvpqaleplpivyyvgrkpkveqlsnmivrsckcs
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6gffK (K:)
    diqvtqsssylsvslgdrvtitckasdhiknwlawyqqkpgiaprllvsgatsleagvps
    rfsgsgsgknftlsitslqtedvatyycqqywstpwtfgggttleirradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrn
    

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >6gffM (M:)
    diqvtqsssylsvslgdrvtitckasdhiknwlawyqqkpgiaprllvsgatsleagvps
    rfsgsgsgknftlsitslqtedvatyycqqywstpwtfgggttleirradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gffM (M:)
    diqvtqsssylsvslgdrvtitckasdhiknwlawyqqkpgiaprllvsgatsleagvps
    rfsgsgsgknftlsitslqtedvatyycqqywstpwtfgggttl
    

  • Chain 'N':
    No sequence available.