PDB entry 6gfe

View 6gfe on RCSB PDB site
Description: High-resolution Structure of a therapeutic full-length anti-NPRA Antibody with exceptional Conformational Diversity
Class: immune system
Keywords: Immunoglobulin, Antibody, natriuretic peptide receptor A, IMMUNE SYSTEM
Deposited on 2018-04-30, released 2019-05-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Immunoglobulin gamma-4 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6GFE (0-End)
  • Chain 'K':
    Compound: Immunoglobulin gamma-4 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6GFE (0-End)
  • Chain 'L':
    Compound: Immunoglobulin gamma-4 light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6GFE (0-214)
    Domains in SCOPe 2.08: d6gfel1, d6gfel2
  • Chain 'M':
    Compound: Immunoglobulin gamma-4 light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6GFE (0-214)
    Domains in SCOPe 2.08: d6gfem1, d6gfem2
  • Heterogens: CA, ACT, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6gfeL (L:)
divltqspatlslspgeratlscrasqsvrsnylawyqqkpgqaprlliygasnratgvp
arfsgsgsgtdftltisslepedfavyycqqisnspptfgqgtkveikrtvaapsvfifp
psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
tlskadyekhkvyacevthqglsspvtksfnrgec

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6gfeM (M:)
divltqspatlslspgeratlscrasqsvrsnylawyqqkpgqaprlliygasnratgvp
arfsgsgsgtdftltisslepedfavyycqqisnspptfgqgtkveikrtvaapsvfifp
psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
tlskadyekhkvyacevthqglsspvtksfnrgec