PDB entry 6gfb

View 6gfb on RCSB PDB site
Description: structure of the btb/poz domain of human 90k
Deposited on 2018-04-29, released 2018-05-09
The last revision was dated 2018-07-11, with a file datestamp of 2018-07-06.
Experiment type: XRAY
Resolution: 2.08 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Galectin-3-binding protein
    Species: Homo sapiens [TaxId:9606]
    Gene: LGALS3BP, M2BP
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Galectin-3-binding protein
    Species: Homo sapiens [TaxId:9606]
    Gene: LGALS3BP, M2BP
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q08380 (Start-128)
      • expression tag (129)
  • Heterogens: ZN, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6gfbA (A:)
    rstnetrsthtldlsrelsealgqifdsqrgcdlsisvnvqgedalgfcghtviltanle
    aqalwkepgsnvtmsvdaecvpmvrdllryfysrriditlssvkcfhklasaygarqlqg
    ycaslfailsrddddkagwshpqfekgggsgggsgggswshpqfek
    

    Sequence, based on observed residues (ATOM records):
    >6gfbA (A:)
    sthtldlsrelsealgqifdsqrgcdlsisvnvqgedalgfcghtviltanleaqalwke
    pgsnvtmsvdaecvpmvrdllryfysrriditlssvkcfhklasaygarqlqgycaslf
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6gfbB (B:)
    rstnetrsthtldlsrelsealgqifdsqrgcdlsisvnvqgedalgfcghtviltanle
    aqalwkepgsnvtmsvdaecvpmvrdllryfysrriditlssvkcfhklasaygarqlqg
    ycaslfailsrddddkagwshpqfekgggsgggsgggswshpqfek
    

    Sequence, based on observed residues (ATOM records):
    >6gfbB (B:)
    sthtldlsrelsealgqifdsqrgcdlsisvnvqgedalgfcghtviltanleaqalwke
    pgsnvtmsvdaecvpmvrdllryfysrriditlssvkcfhklasaygarqlqgycaslfa
    ils