PDB entry 6gf8

View 6gf8 on RCSB PDB site
Description: molecular basis of egg coat filament cross-linking: structure of the glycosylated zp1 zp-n1 domain homodimer
Deposited on 2018-04-29, released 2019-06-19
The last revision was dated 2021-10-20, with a file datestamp of 2021-10-15.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Zona pellucida sperm-binding protein 1,Zona pellucida sperm-binding protein 1
    Species: Gallus gallus [TaxId:9031]
    Gene: ZP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A140JXP0 (5-120)
      • expression tag (0-4)
      • engineered mutation (102)
      • expression tag (121-126)
    • Uniprot A0A140JXP0 (127-135)
      • engineered mutation (135)
  • Chain 'B':
    Compound: Zona pellucida sperm-binding protein 1,Zona pellucida sperm-binding protein 1
    Species: Gallus gallus [TaxId:9031]
    Gene: ZP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A140JXP0 (5-120)
      • expression tag (0-4)
      • engineered mutation (102)
      • expression tag (121-126)
    • Uniprot A0A140JXP0 (127-135)
      • engineered mutation (135)
  • Heterogens: MPD

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6gf8A (A:)
    daaqpallqyhydcgdfgmqllayptrgrtvhfkvldefgtrfevancsicmhwlntged
    gglifsagyegchvlvkdgryvlrvqleemllsgvvaasyevqmtcprpagyeilrdekv
    hhhhhhhhqrpdrgns
    

    Sequence, based on observed residues (ATOM records):
    >6gf8A (A:)
    llqyhydcgdfgmqllayptrgrtvhfkvldefgtrfevancsicmhwlntgedgglifs
    agyegchvlvkdgryvlrvqleemllsgvvaasyevqmtcprp
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6gf8B (B:)
    daaqpallqyhydcgdfgmqllayptrgrtvhfkvldefgtrfevancsicmhwlntged
    gglifsagyegchvlvkdgryvlrvqleemllsgvvaasyevqmtcprpagyeilrdekv
    hhhhhhhhqrpdrgns
    

    Sequence, based on observed residues (ATOM records):
    >6gf8B (B:)
    pallqyhydcgdfgmqllayptrgrtvhfkvldefgtrfevancsicmhwlntgedggli
    fsagyegchvlvkdgryvlrvqleemllsgvvaasyevqmtcprp