PDB entry 6gf2

View 6gf2 on RCSB PDB site
Description: the structure of the ubiquitin-like modifier fat10 reveals a novel targeting mechanism for degradation by the 26s proteasome
Deposited on 2018-04-29, released 2018-08-08
The last revision was dated 2018-08-29, with a file datestamp of 2018-08-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin D
    Species: Homo sapiens [TaxId:9606]
    Gene: UBD, FAT10
    Database cross-references and differences (RAF-indexed):
    • Uniprot O15205 (4-84)
      • expression tag (0-3)
      • conflict (53)
      • conflict (79)
      • conflict (81)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6gf2A (A:)
gamgdeelplflvesgdeakrhllqvrrsssvaqvkamietktgiipetqivtlngkrle
dgkmmadygirkgnllflasysigg